7TV0: BRD4 bromodomain 1
Crystal structure of BRD4 bromodomain 1 in complex with dual-acetylated SARS-CoV-2 E. Determined by X-ray diffraction at 2.6 Å resolution. Released 6 Jul 2022.
- Method
- X-ray diffraction
- Resolution
- 2.6 Å
- Organisms
- Homo sapiens, Severe acute respiratory syndrome coronavirus 2
- Chains
- 6
- Atoms
- 4,996
- Mol. weight
- 68.57 kDa
- Released
- 6 Jul 2022
Explore 7TV0 in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
7TV0 contains 40 α-helices and 8 β-strands across 6 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chain A: 9 helices, 2 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 45-49 | 5 | |
| β-strand | 57-60 | 4 | 1 |
| α-helix | 61-65 | 5 | |
| α-helix | 66-70 | 5 | |
| α-helix | 71-75 | 5 | |
| α-helix | 81-83 | 3 | |
| α-helix | 97-100 | 4 | |
| α-helix | 107-115 | 9 | |
| α-helix | 122-139 | 18 | |
| α-helix | 145-162 | 18 | |
| β-strand | 170-174 | 5 | 1 |
Chain B: 9 helices, 2 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 43-49 | 7 | |
| β-strand | 57-59 | 3 | 2 |
| α-helix | 61-65 | 5 | |
| α-helix | 66-70 | 5 | |
| α-helix | 71-76 | 6 | |
| α-helix | 89-92 | 4 | |
| α-helix | 97-100 | 4 | |
| α-helix | 107-115 | 9 | |
| α-helix | 122-139 | 18 | |
| α-helix | 145-161 | 17 | |
| β-strand | 172-174 | 3 | 2 |
Chain C: 10 helices, 2 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 44-49 | 6 | |
| β-strand | 57-60 | 4 | 3 |
| α-helix | 61-65 | 5 | |
| α-helix | 66-71 | 6 | |
| α-helix | 72-75 | 4 | |
| α-helix | 81-83 | 3 | |
| α-helix | 97-100 | 4 | |
| α-helix | 107-116 | 10 | |
| α-helix | 122-139 | 18 | |
| α-helix | 141 | 1 | |
| α-helix | 145-161 | 17 | |
| β-strand | 170-174 | 5 | 3 |
Chain D: 10 helices, 2 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 44-49 | 6 | |
| β-strand | 57-60 | 4 | 4 |
| α-helix | 61-65 | 5 | |
| α-helix | 66-71 | 6 | |
| α-helix | 72-75 | 4 | |
| α-helix | 78-80 | 3 | |
| α-helix | 97-100 | 4 | |
| α-helix | 107-116 | 10 | |
| α-helix | 122-139 | 18 | |
| α-helix | 141 | 1 | |
| α-helix | 145-162 | 18 | |
| β-strand | 170-174 | 5 | 4 |
Chain E: 1 helix, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 8-15 | 8 | |
Chain G: 1 helix, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 6-13 | 8 | |
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| Bromodomain-containing protein 4 | A, B, C, D | protein | 139 | Homo sapiens | O60885 (AlphaFold model) |
| Envelope small membrane protein | E, G | protein | 12 | Severe acute respiratory syndrome coronavirus 2 | P0DTC4 (AlphaFold model) |
Sequence of entity 1 (A, B, C, D), FASTA
>7TV0_1 Bromodomain-containing protein 4 (chains A, B, C, D)
STNPPPPETSNPNKPKRQTNQLQYLLRVVLKTLWKHQFAWPFQQPVDAVKLNLPDYYKII
KTPMDMGTIKKRLENNYYWNAQECIQDFNTMFTNCYIYNKPGDDIVLMAEALEKLFLQKI
NELPTEETEIMIVQAKGRG
Sequence of entity 2 (E, G), FASTA
>7TV0_2 Envelope small membrane protein (chains E, G)
KPSFYVYSRVKN
Primary citation
Binding of the SARS-CoV-2 envelope E protein to human BRD4 is essential for infection. Vann, K.R., Acharya, A., Jang, S.M. et al. Structure (2022) 30:1224. DOI 10.1016/j.str.2022.05.020 · PubMed
Other PDB entries of the same protein (UniProt O60885 (AlphaFold model), which also has an AlphaFold model), best resolution first:
- 4QB3 0.94 Å, Crystal structure of the first bromodomain of human BRD4 in complex with Olinone
- 6FO5 0.95 Å, First domain of human bromodomain BRD4 in complex with inhibitor #17
- 7Z9W 0.99 Å, BRD4 in complex with FragLite1
- 4ZC9 0.99 Å, Crystal Structure of the BRD4a/DB-2-190 complex
- 9P34 0.99 Å, Crystal structure of the Bromo domain 1 in human Bromodomain Containing Protein 4 with a…
- 6I7Y 1.0 Å, Crystal Structure of the first bromodomain of BRD4 in complex with RT56
- 7ZAJ 1.0 Å, BRD4 in complex with FragLite16
- 8YMG 1.01 Å, BRD4-BD1 in complex with 7-[4-chloro-1-(tetrahydropyran-4-ylmethyl)imidazol-2-yl]-5-methy…
- 8YMI 1.01 Å, BRD4-BD1 in complex with 2-{[(3S)-1-benzylpyrrolidin-3-yl]methyl}-5-methyl-7-(1-methylpyr…
- 9P33 1.01 Å, Crystal structure of the Bromo domain 1 in human Bromodomain Containing Protein 4 with a…
- 8YMF 1.01 Å, BRD4-BD1 in complex with 7-[2-(cyclopropylmethoxy)phenyl]-5-methyl-2-[(1-methylsulfonyl-4…
- 7Z9Y 1.04 Å, BRD4 in complex with FragLite2
Browse structure collections
About this viewer
MolViewer shows 7TV0 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.