7U5C: Human CST

Cryo-EM structure of human CST bound to DNA polymerase alpha-primase in a recruitment state. Determined by electron microscopy at 4.6 Å resolution. Released 18 May 2022.

Method: Electron microscopy
Resolution: 4.6 Å
Organism: Homo sapiens
Chains: 8
Atoms: 30,077
Mol. weight: 502.12 kDa
Ligands: ZN, SF4
Released: 18 May 2022

Explore 7U5C in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7U5C contains 143 α-helices and 169 β-strands across 7 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 22 helices, 14 β-strands

Element	Residues	Length	Sheet
α-helix	9-19	11
α-helix	23-31	9
α-helix	32-34	3
β-strand	44-49	6	1
β-strand	53-58	6	1
α-helix	63-73	11
β-strand	77-81	5	1
β-strand	83-84	2	2
α-helix	95	1
β-strand	101-103	3	2
β-strand	106-110	5	3
α-helix	113-117	5
α-helix	129-149	21
β-strand	157-159	3	3
β-strand	165-169	5	3
α-helix	174-176	3
α-helix	179-189	11
α-helix	210-225	16
α-helix	226-231	6
α-helix	237-241	5
α-helix	244-246	3
α-helix	254-259	6
α-helix	267-278	12
α-helix	291-300	10
α-helix	304-306	3
β-strand	317-318	2	1
α-helix	319	1
β-strand	323	1	4
β-strand	329	1	5
β-strand	330	1	4
β-strand	332-334	3	3
α-helix	336-339	4
α-helix	348	1
β-strand	349	1	5
α-helix	350-357	8
α-helix	388-405	18

Chain B: 23 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	36	1	6
α-helix	39-62	24
α-helix	68-80	13
α-helix	94-106	13
α-helix	114-132	19
α-helix	137-147	11
β-strand	152-153	2	7
α-helix	157-161	5
α-helix	163-169	7
β-strand	184-185	2	7
α-helix	188-190	3
β-strand	201	1	8
β-strand	208	1	8
β-strand	209	1	7
α-helix	211-234	24
α-helix	238-241	4
α-helix	248-251	4
α-helix	275-283	9
α-helix	286-298	13
α-helix	306-313	8
α-helix	320-332	13
α-helix	340-343	4
α-helix	345-351	7
α-helix	367-370	4
α-helix	385-388	4
α-helix	391-399	9
α-helix	405-416	12
α-helix	421-432	12
α-helix	444-453	10

Chain C: 45 helices, 43 β-strands

Element	Residues	Length	Sheet
β-strand	342-344	3	9
β-strand	347-350	4	9
β-strand	359-367	9	9
β-strand	372-380	9	9
β-strand	384-391	8	10
α-helix	410-424	15
β-strand	431-437	7	10
β-strand	438	1	11
β-strand	450-458	9	10
β-strand	473-477	5	10
α-helix	483-491	9
β-strand	498-500	3	9
β-strand	501	1	12
β-strand	505	1	9
β-strand	518-520	3	9
β-strand	526	1	12
β-strand	529	1	9
α-helix	533-536	4
β-strand	537-549	13	13
β-strand	554-568	15	13
β-strand	581-586	6	13
α-helix	598-602	5
β-strand	611	1	13
α-helix	615-629	15
β-strand	633-635	3	13
α-helix	639-643	5
α-helix	644-654	11
α-helix	659-662	4
α-helix	682-684	3
β-strand	689-690	2	13
α-helix	696-699	4
α-helix	711-714	4
α-helix	725-727	3
α-helix	728-732	5
α-helix	736-759	24
α-helix	761-772	12
α-helix	776-778	3
α-helix	786-796	11
β-strand	801	1	11
β-strand	852	1	14
β-strand	856-860	5	14
α-helix	865-872	8
α-helix	876-878	3
α-helix	901-903	3
α-helix	907-908	2
α-helix	911-929	19
α-helix	936-955	20
α-helix	958-961	4
α-helix	971-993	23
β-strand	1000-1002	3	14
β-strand	1005-1009	5	14
α-helix	1016-1032	17
β-strand	1039-1051	13	14
β-strand	1054-1061	8	14
β-strand	1069-1075	7	14
α-helix	1086-1099	14
α-helix	1105-1124	20
α-helix	1130-1133	4
β-strand	1135-1137	3	15
α-helix	1155-1164	10
β-strand	1175-1177	3	15
β-strand	1178-1179	2	16
β-strand	1181	1	17
β-strand	1192-1193	2	16
α-helix	1195-1198	4
β-strand	1205	1	17
α-helix	1210-1211	2
α-helix	1212-1216	5
α-helix	1217-1224	8
α-helix	1232-1239	8
α-helix	1243-1247	5
α-helix	1270-1272	3
β-strand	1280-1282	3	18
β-strand	1289-1291	3	18
β-strand	1296	1	19
α-helix	1300-1302	3
β-strand	1305	1	19
α-helix	1319-1322	4
α-helix	1323-1342	20
β-strand	1346-1348	3	20
β-strand	1356-1357	2	20
β-strand	1379-1381	3	20
α-helix	1385-1398	14
α-helix	1401-1406	6
α-helix	1411-1421	11
α-helix	1424-1442	19
β-strand	1450	1	6
α-helix	1451-1453	3

Chain D: 12 helices, 22 β-strands

Element	Residues	Length	Sheet
α-helix	159-162	4
β-strand	170-175	6	21
β-strand	193-195	3	22
α-helix	213-235	23
β-strand	247-259	13	23
β-strand	270-273	4	23
β-strand	283-285	3	23
β-strand	295-296	2	24
β-strand	301-308	8	23
β-strand	315-318	4	23
α-helix	324-326	3
β-strand	341-345	5	21
α-helix	358-370	13
β-strand	374-378	5	21
α-helix	387-390	4
α-helix	399-414	16
β-strand	419-423	5	21
β-strand	437	1	25
α-helix	438-441	4
α-helix	447-449	3
β-strand	454-455	2	21
β-strand	458	1	25
β-strand	460-464	5	22
β-strand	467-471	5	22
α-helix	476-481	6
β-strand	485-486	2	24
α-helix	494-504	11
α-helix	514-515	2
α-helix	522-528	7
β-strand	537-539	3	22
β-strand	547-550	4	22
β-strand	555-558	4	22
β-strand	572-576	5	21
β-strand	590-596	7	21

Chain E: 33 helices, 72 β-strands

Element	Residues	Length	Sheet
α-helix	10-16	7
α-helix	18-22	5
α-helix	23-26	4
α-helix	39-53	15
α-helix	70-72	3
α-helix	73-76	4
β-strand	83	1	26
α-helix	89-92	4
β-strand	105	1	27
α-helix	106-107	2
β-strand	113-118	6	28
β-strand	134-136	3	28
β-strand	141-142	2	28
β-strand	145	1	29
β-strand	156-160	5	28
β-strand	163	1	26
β-strand	164-166	3	29
β-strand	178-180	3	29
α-helix	207-209	3
β-strand	226-233	8	30
β-strand	237	1	31
β-strand	244	1	31
β-strand	245-250	6	30
β-strand	259-263	5	30
α-helix	269-272	4
β-strand	280-283	4	30
β-strand	308-309	2	30
α-helix	346-349	4
β-strand	350-352	3	32
β-strand	358-361	4	33
β-strand	362-367	6	34
β-strand	372-375	4	34
β-strand	381	1	35
α-helix	390-392	3
β-strand	400-403	4	33
β-strand	407-409	3	35
β-strand	420-422	3	35
β-strand	430	1	33
β-strand	437	1	27
α-helix	443-447	5
α-helix	450-452	3
α-helix	453-460	8
α-helix	464-480	17
α-helix	488-492	5
α-helix	503-506	4
α-helix	508-513	6
α-helix	524	1
α-helix	525-529	5
β-strand	539-541	3	32
α-helix	552-565	14
α-helix	570-572	3
α-helix	577-579	3
α-helix	585-589	5
β-strand	592-597	6	36
β-strand	608-613	6	37
β-strand	622-625	4	37
β-strand	628-630	3	37
β-strand	650-654	5	37
β-strand	658-667	10	36
β-strand	681-691	11	36
β-strand	698-700	3	37
β-strand	729-738	10	38
β-strand	742-744	3	39
β-strand	760-762	3	39
β-strand	763-773	11	38
β-strand	776-777	2	40
β-strand	780-781	2	40
α-helix	787-789	3
β-strand	797-800	4	38
α-helix	802-807	6
β-strand	815-821	7	38
β-strand	830	1	41
β-strand	832	1	41
β-strand	851-853	3	38
β-strand	859-862	4	38
α-helix	883-886	4
β-strand	895-901	7	42
β-strand	905-907	3	43
α-helix	911-912	2
α-helix	913-915	3
β-strand	929-933	5	43
β-strand	934-936	3	42
β-strand	946-950	5	43
β-strand	966-976	11	42
β-strand	982-985	4	42
β-strand	991-996	6	42
β-strand	1010	1	44
β-strand	1024-1028	5	44
β-strand	1030-1034	5	45
β-strand	1036-1042	7	45
β-strand	1049	1	45
β-strand	1050-1051	2	46
β-strand	1054-1055	2	46
β-strand	1068-1078	11	45
β-strand	1085-1089	5	45
α-helix	1094-1097	4
α-helix	1101-1110	10
β-strand	1116-1120	5	45
α-helix	1137-1146	10
β-strand	1156-1161	6	44
β-strand	1175	1	47
β-strand	1179-1180	2	48
β-strand	1185-1186	2	48
β-strand	1190	1	47
β-strand	1196-1202	7	44

Chain F: 7 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	14-16	3
β-strand	27-28	2	49
α-helix	31-35	5
β-strand	57-63	7	49
β-strand	72-78	7	49
β-strand	83-89	7	49
α-helix	110-112	3
α-helix	113-120	8
β-strand	131-141	11	49
β-strand	144-154	11	49
α-helix	157-159	3
α-helix	163-173	11
α-helix	174-178	5

Chain G: 1 helix, 6 β-strands

Element	Residues	Length	Sheet
β-strand	25-31	7	50
β-strand	36	1	50
β-strand	41-46	6	50
β-strand	53-58	6	50
β-strand	72-79	8	50
β-strand	88-97	10	50
α-helix	102-115	14

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
DNA primase small subunit	A	protein	420	Homo sapiens	P49642 (AlphaFold model)
DNA primase large subunit	B	protein	512	Homo sapiens	P49643 (AlphaFold model)
DNA polymerase alpha catalytic subunit	C	protein	1132	Homo sapiens	P09884 (AlphaFold model)
DNA polymerase alpha subunit B	D	protein	598	Homo sapiens	Q14181 (AlphaFold model)
CST complex subunit CTC1	E	protein	1221	Homo sapiens	Q2NKJ3
CST complex subunit STN1	F	protein	368	Homo sapiens	Q9H668
CST complex subunit TEN1	G	protein	123	Homo sapiens	Q86WV5
canonical telomeric DNA sequence	H	DNA	18	Homo sapiens

Sequence of entity 1 (A), FASTA

>7U5C_1 DNA primase small subunit (chains A)
METFDPTELPELLKLYYRRLFPYSQYYRWLNYGGVIKNYFQHREFSFTLKDDIYIRYQSF
NNQSDLEKEMQKMNPYKIDIGAVYSHRPNQHNTVKLGAFQAQEKELVFDIDMTDYDDVRR
CCSSADICPKCWTLMTMAIRIIDRALKEDFGFKHRLWVYSGRRGVHCWVCDESVRKLSSA
VRSGIVEYLSLVKGGQDVKKKVHLSEKIHPFIRKSINIIKKYFEEYALVNQDILENKESW
DKILALVPETIHDELQQSFQKSHNSLQRWEHLKKVASRYQNNIKNDKYGPWLEWEIMLQY
CFPRLDINVSKGINHLLKSPFSVHPKTGRISVPIDLQKVDQFDPFTVPTISFICRELDAI
STNEEEKEENEAESDVKHRTRDYKKTSLAPYVKVFEHFLENLDKSRKGELLKKSDLQKDF

Sequence of entity 2 (B), FASTA

>7U5C_2 DNA primase large subunit (chains B)
GGSMEFSGRKWRKLRLAGDQRNASYPHCLQFYLQPPSENISLIEFENLAIDRVKLLKSVE
NLGVSYVKGTEQYQSKLESELRKLKFSYRENLEDEYEPRRRDHISHFILRLAYCQSEELR
RWFIQQEMDLLRFRFSILPKDKIQDFLKDSQLQFEAISDEEKTLREQEIVASSPSLSGLK
LGFESIYKIPFADALDLFRGRKVYLEDGFAYVPLKDIVAIILNEFRAKLSKALALTARSL
PAVQSDERLQPLLNHLSHSYTGQDYSTQGNVGKISLDQIDLLSTKSFPPCMRQLHKALRE
NHHLRHGGRMQYGLFLKGIGLTLEQALQFWKQEFIKGKMDPDKFDKGYSYNIRHSFGKEG
KRTDYTPFSCLKIILSNPPSQGDYHGCPFRHSDPELLKQKLQSYKISPGGISQILDLVKG
THYQVACQKYFEMIHNVDDCGFSLNHPNQFFCESQRILNGGKDIKKEPIQPETPQPKPSV
QKTKDASSALASLNSSLEMDMEGLEDYFSEDS

Sequence of entity 3 (C), FASTA

>7U5C_3 DNA polymerase alpha catalytic subunit (chains C)
GPGSADEEQVFHFYWLDAYEDQYNQPGVVFLFGKVWIESAETHVSCCVMVKNIERTLYFL
PREMKIDLNTGKETGTPISMKDVYEEFDEKIATKYKIMKFKSKPVEKNYAFEIPDVPEKS
EYLEVKYSAEMPQLPQDLKGETFSHVFGTNTSSLELFLMNRKIKGPCWLEVKSPQLLNQP
VSWCKVEAMALKPDLVNVIKDVSPPPLVVMAFSMKTMQNAKNHQNEIIAMAALVHHSFAL
DKAAPKPPFQSHFCVVSKPKDCIFPYAFKEVIEKKNVKVEVAATERTLLGFFLAKVHKID
PDIIVGHNIYGFELEVLLQRINVCKAPHWSKIGRLKRSNMPKLGGRSGFGERNATCGRMI
CDVEISAKELIRCKSYHLSELVQQILKTERVVIPMENIQNMYSESSQLLYLLEHTWKDAK
FILQIMCELNVLPLALQITNIAGNIMSRTLMGGRSERNEFLLLHAFYENNYIVPDKQIFR
KPQQKLGDEDEEIDGDTNKYKKGRKKAAYAGGLVLDPKVGFYDKFILLLDFNSLYPSIIQ
EFNICFTTVQRVASEAQKVTEDGEQEQIPELPDPSLEMGILPREIRKLVERRKQVKQLMK
QQDLNPDLILQYDIRQKALKLTANSMYGCLGFSYSRFYAKPLAALVTYKGREILMHTKEM
VQKMNLEVIYGDTDSIMINTNSTNLEEVFKLGNKVKSEVNKLYKLLEIDIDGVFKSLLLL
KKKKYAALVVEPTSDGNYVTKQELKGLDIVRRDWCDLAKDTGNFVIGQILSDQSRDTIVE
NIQKRLIEIGENVLNGSVPVSQFEINKALTKDPQDYPDKKSLPHVHVALWINSQGGRKVK
AGDTVSYVICQDGSNLTASQRAYAPEQLQKQDNLTIDTQYYLAQQIHPVVARICEPIDGI
DAVLIATWLGLDPTQFRVHHYHKDEENDALLGGPAQLTDEEKYRDCERFKCPCPTCGTEN
IYDNVFDGSGTDMEPSLYRCSNIDCKASPLTFTVQLSNKLIMDIRRFIKKYYDGWLICEE
PTCRNRTRHLPLQFSRTGPLCPACMKATLQPEYSDKSLYTQLCFYRYIFDAECALEKLTT
DHEKDKLKKQFFTPKVLQDYRKLKNTAEQFLSRSGYSEVNLSKLFAGCAVKS

Sequence of entity 4 (D), FASTA

>7U5C_4 DNA polymerase alpha subunit B (chains D)
MSASAQQLAEELQIFGLDCEEALIEKLVELCVQYGQNEEGMVGELIAFCTSTHKVGLTSE
ILNSFEHEFLSKRLSKARHSTCKDSGHAGARDIVSIQELIEVEEEEEILLNSYTTPSKGS
QKRAISTPETPLTKRSVSTRSPHQLLSPSSFSPSATPSQKYNSRSNRGEVVTSFGLAQGV
SWSGRGGAGNISLKVLGCPEALTGSYKSMFQKLPDIREVLTCKIEELGSELKEHYKIEAF
TPLLAPAQEPVTLLGQIGCDSNGKLNNKSVILEGDREHSSGAQIPVDLSELKEYSLFPGQ
VVIMEGINTTGRKLVATKLYEGVPLPFYQPTEEDADFEQSMVLVACGPYTTSDSITYDPL
LDLIAVINHDRPDVCILFGPFLDAKHEQVENCLLTSPFEDIFKQCLRTIIEGTRSSGSHL
VFVPSLRDVHHEPVYPQPPFSYSDLSREDKKQVQFVSEPCSLSINGVIFGLTSTDLLFHL
GAEEISSSSGTSDRFSRILKHILTQRSYYPLYPPQEDMAIDYESFYVYAQLPVTPDVLII
PSELRYFVKDVLGCVCVNPGRLTKGQVGGTFARLYLRRPAADGAERQSPCIAVQVVRI

Sequence of entity 5 (E), FASTA

>7U5C_5 CST complex subunit CTC1 (chains E)
GPGSMAAGRAQVPSSEQAWLEDAQVFIQKTLCPAVKEPNVQLTPLVIDCVKTVWLSQGRN
QGSTLPLSYSFVSVQDLKTHQRLPCCSHLSWSSSAYQAWAQEAGPNGNPLPREQLLLLGT
LTDLSADLEQECRNGSLYVRDNTGVLSCELIDLDLSWLGHLFLFPRWSYLPPARWNSSGE
GHLELWDAPVPVFPLTISPGPVTPIPVLYPESASCLLRLRNKLRGVQRNLAGSLVRLSAL
VKSKQKAYFILSLGRSHPAVTHVSIIVQVPAQLVWHRALRPGTAYVLTELRVSKIRGQRQ
HVWMTSQSSRLLLLKPECVQELELELEGPLLEADPKPLPMPSNSEDKKDPESLVRYSRLL
SYSGAVTGVLNEPAGLYELDGQLGLCLAYQQFRGLRRVMRPGVCLQLQDVHLLQSVGGGT
RRPVLAPCLRGAVLLQSFSRQKPGAHSSRQAYGASLYEQLVWERQLGLPLYLWATKALEE
LACKLCPHVLRHHQFLQHSSPGSPSLGLQLLAPTLDLLAPPGSPVRNAHNEILEEPHHCP
LQKYTRLQTPSSFPTLATLKEEGQRKAWASFDPKALLPLPEASYLPSCQLNRRLAWSWLC
LLPSAFCPAQVLLGVLVASSHKGCLQLRDQSGSLPCLLLAKHSQPLSDPRLIGCLVRAER
FQLIVERDVRSSFPSWKELSMPGFIQKQQARVYVQFFLADALILPVPRPCLHSATPSTPQ
TDPTGPEGPHLGQSRLFLLCHKEALMKRNFCVPPGASPEVPKPALSFYVLGSWLGGTQRK
EGTGWGLPEPQGNDDNDQKVHLIFFGSSVRWFEFLHPGQVYRLIAPGPATPMLFEKDGSS
CISRRPLELAGCASCLTVQDNWTLELESSQDIQDVLDANKSLPESSLTDLLSDNFTDSLV
SFSAEILSRTLCEPLVASLWMKLGNTGAMRRCVKLTVALETAECEFPPHLDVYIEDPHLP
PSLGLLPGARVHFSQLEKRVSRSHNVYCCFRSSTYVQVLSFPPETTISIPLPHIYLAELL
QGGQSPFQATASCHIVSVFSLQLFWVCAYCTSICRQGKCTRLGSTCPTQTAISQAIIRLL
VEDGTAEAVVTCRNHHVAAALGLCPREWASLLDFVQVPGRVVLQFAGPGAQLESSARVDE
PMTMFLWTLCTSPSVLRPIVLSFELERKPSKIVPLEPPRLQRFQCGELPFLTHVNPRLRL
SCLSIRESEYSSSLGILASSC

Sequence of entity 6 (F), FASTA

>7U5C_6 CST complex subunit STN1 (chains F)
MQPGSSRCEEETPSLLWGLDPVFLAFAKLYIRDILDMKESRQVPGVFLYNGHPIKQVDVL
GTVIGVRERDAFYSYGVDDSTGVINCICWKKLNTESVSAAPSAARELSLTSQLKKLQETI
EQKTKIEIGDTIRVRGSIRTYREEREIHATTYYKVDDPVWNIQIARMLELPTIYRKVYDQ
PFHSSALEKEEALSNPGALDLPSLTSLLSEKAKEFLMENRVQSFYQQELEMVESLLSLAN
QPVIHSASSDQVNFKKDTTSKAIHSIFKNAIQLLQEKGLVFQKDDGFDNLYYVTREDKDL
HRKIHRIIQQDCQKPNHMEKGCHFLHILACARLSIRPGLSEAVLQQVLELLEDQSDIVST
MEHYYTAF

Sequence of entity 7 (G), FASTA

>7U5C_7 CST complex subunit TEN1 (chains G)
MMLPKPGTYYLPWEVSAGQVPDGSTLRTFGRLCLYDMIQSRVTLMAQHGSDQHQVLVCTK
LVEPFHAQVGSLYIVLGELQHQQDRGSVVKARVLTCVEGMNLPLLEQAIREQRLYKQERG
GSQ

Sequence of entity 8 (H), FASTA

>7U5C_8 canonical telomeric DNA sequence (chains H)
GGTTAGGGTTAGGGTTAG

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	4
SF4	Iron/sulfur cluster	Fe4 S4	1

Primary citation

Cryo-EM structure of the human CST-Pol alpha /primase complex in a recruitment state. Cai, S.W., Zinder, J.C., Svetlov, V. et al. Nat Struct Mol Biol (2022) 29:813-819. DOI 10.1038/s41594-022-00766-y · PubMed

Other PDB entries of the same protein (UniProt P49642 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6RB4 1.5 Å, Crystal structure of the Pri1 subunit of human primase
4LIK 1.7 Å, Crystal structure of the catalytic subunit of human primase
6R5E 1.85 Å, Crystal structure of the Pri1 subunit of human primase bound to 2F-ATP
6R5D 1.95 Å, Crystal structure of the Pri1 subunit of human primase bound to dATP
4MHQ 2.2 Å, Crystal structure of human primase catalytic subunit
6R4U 2.2 Å, Crystal structure of the Pri1 subunit of human primase bound to fludarabine triphosphate
6R4T 2.35 Å, Crystal structure of the Pri1 subunit of human primase bound to vidarabine triphosphate
4LIL 2.6 Å, Crystal structure of the catalytic subunit of human primase bound to UTP and Mn
4RR2 2.65 Å, Crystal structure of human primase
4BPU 2.7 Å, Crystal structure of human primase in heterodimeric form, comprising PriS and truncated…
6R4S 2.75 Å, Crystal structure of the Pri1 subunit of human primase bound to ATP
8VY3 2.98 Å, Human DNA polymerase alpha/primase - AavLEA1 (1:40 molar ratio)

Browse structure collections

About this viewer

MolViewer shows 7U5C directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.