7UI9: Core Mediator-PICearly

Name: PDB 7UI9: Core Mediator-PICearly (Copy A)
Published: 2023-02-15
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: transcription

Core Mediator-PICearly (Copy A). Determined by electron microscopy at 3.3 Å resolution. Released 15 Feb 2023.

Method: Electron microscopy
Resolution: 3.3 Å
Organism: Saccharomyces cerevisiae S288C
Chains: 33
Atoms: 63,137
Mol. weight: 1247.86 kDa
Released: 15 Feb 2023

Explore 7UI9 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7UI9 contains 349 α-helices and 337 β-strands across 33 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain a: 12 helices, 22 β-strands

Element	Residues	Length	Sheet
α-helix	7-21	15
α-helix	28-37	10
β-strand	41-46	6	17
β-strand	51-57	7	17
β-strand	61-68	8	17
β-strand	73-81	9	17
β-strand	91	1	18
β-strand	102	1	18
α-helix	103-109	7
α-helix	115-130	16
α-helix	164-181	18
β-strand	187-190	4	19
β-strand	198-203	6	19
β-strand	209-219	11	19
β-strand	227-229	3	20
β-strand	232-234	3	21
β-strand	239-241	3	21
β-strand	248-250	3	20
β-strand	252-258	7	19
β-strand	272-274	3	22
α-helix	280-282	3
β-strand	283-286	4	19
α-helix	298-304	7
β-strand	312-316	5	23
β-strand	322-324	3	22
β-strand	325-329	5	19
α-helix	332-336	5
α-helix	337-347	11
α-helix	348-352	5
α-helix	353-360	8
β-strand	528-532	5	23
β-strand	536-539	4	23
β-strand	543-546	4	23
α-helix	551-565	15

Chain A: 82 helices, 71 β-strands

Element	Residues	Length	Sheet
α-helix	10	1
β-strand	11	1	42
β-strand	14-18	5	43
α-helix	24-30	7
β-strand	34	1	44
β-strand	41	1	45
β-strand	48	1	45
α-helix	49	1
β-strand	82-91	10	44
α-helix	96-104	9
β-strand	106	1	46
β-strand	113	1	46
α-helix	120-126	7
α-helix	131-142	12
β-strand	147	1	47
β-strand	151-153	3	48
β-strand	161-163	3	48
β-strand	170	1	47
β-strand	173-177	5	49
β-strand	180-185	6	49
α-helix	189-191	3
β-strand	198-201	4	49
α-helix	202-203	2
α-helix	204-212	9
α-helix	216-222	7
α-helix	232-234	3
β-strand	235-241	7	44
α-helix	248-249	2
β-strand	250-253	4	50
β-strand	256-258	3	50
α-helix	261-280	20
α-helix	286-304	19
α-helix	312-314	3
β-strand	315	1	51
α-helix	316	1
α-helix	320	1
β-strand	321	1	51
α-helix	322	1
α-helix	326-329	4
α-helix	335	1
α-helix	336-340	5
β-strand	343-345	3	52
β-strand	348-352	5	53
β-strand	355	1	54
β-strand	363-367	5	53
α-helix	368-373	6
β-strand	375-379	5	2
α-helix	380	1
α-helix	385-394	10
β-strand	402-406	5	2
β-strand	412-414	3	2
α-helix	424-426	3
β-strand	431-435	5	2
α-helix	436	1
β-strand	441-445	5	53
α-helix	452-454	3
β-strand	455-463	9	53
β-strand	469	1	53
β-strand	470	1	54
β-strand	486-490	5	53
α-helix	495-503	9
β-strand	506	1	53
α-helix	507-509	3
β-strand	512-513	2	55
β-strand	518-519	2	55
α-helix	525-534	10
β-strand	540-541	2	56
α-helix	543-552	10
α-helix	559-563	5
β-strand	565-567	3	11
β-strand	571	1	11
β-strand	572-573	2	56
α-helix	574-578	5
β-strand	588-590	3	57
β-strand	605-608	4	57
β-strand	611-614	4	57
α-helix	619-622	4
α-helix	629-636	8
α-helix	639-660	22
α-helix	666-668	3
α-helix	673-697	25
α-helix	702-704	3
α-helix	710-736	27
α-helix	742-749	8
α-helix	755-758	4
α-helix	759-763	5
β-strand	766-767	2	58
β-strand	770	1	59
β-strand	773	1	59
α-helix	794-796	3
β-strand	799-800	2	58
α-helix	810-845	36
β-strand	849-850	2	60
β-strand	856-857	2	60
β-strand	863-865	3	60
α-helix	868-870	3
β-strand	873	1	61
β-strand	878-882	5	62
α-helix	890-897	8
α-helix	904-906	3
α-helix	907-909	3
β-strand	913	1	63
α-helix	916-919	4
α-helix	924-946	23
β-strand	953-957	5	62
α-helix	960-970	11
β-strand	979	1	63
α-helix	983-995	13
α-helix	1005-1025	21
α-helix	1028-1029	2
α-helix	1030-1035	6
α-helix	1039-1054	16
β-strand	1057	1	61
α-helix	1058-1059	2
α-helix	1064-1078	15
α-helix	1083-1088	6
α-helix	1090-1092	3
α-helix	1098-1106	9
β-strand	1116-1119	4	12
β-strand	1120	1	64
α-helix	1128-1138	11
β-strand	1141-1142	2	65
α-helix	1143-1145	3
β-strand	1147-1154	8	66
α-helix	1164-1174	11
α-helix	1179-1184	6
α-helix	1185-1187	3
β-strand	1191-1197	7	66
α-helix	1199-1204	6
α-helix	1209-1210	2
α-helix	1211-1215	5
α-helix	1216-1221	6
β-strand	1224-1228	5	66
β-strand	1236-1242	7	66
α-helix	1250-1254	5
α-helix	1256-1269	14
β-strand	1272-1274	3	65
β-strand	1281-1292	12	12
β-strand	1298-1309	12	12
α-helix	1313-1316	4
β-strand	1322	1	64
β-strand	1328-1329	2	12
α-helix	1332-1338	7
α-helix	1341-1357	17
α-helix	1365-1375	11
α-helix	1386-1389	4
α-helix	1396-1400	5
α-helix	1405-1415	11
β-strand	1418-1419	2	43
α-helix	1424-1429	6
β-strand	1437	1	67
β-strand	1441-1445	5	3
α-helix	1447-1452	6

Chain B: 52 helices, 72 β-strands

Element	Residues	Length	Sheet
α-helix	27-40	14
α-helix	45-53	9
α-helix	54-58	5
α-helix	59-65	7
β-strand	69-73	5	68
α-helix	80-82	3
β-strand	84-97	14	68
α-helix	98-100	3
β-strand	101-103	3	69
β-strand	109-111	3	69
α-helix	114-120	7
β-strand	125-140	16	68
β-strand	150-156	7	68
α-helix	161-163	3
β-strand	164-171	8	68
β-strand	173	1	70
α-helix	180-183	4
α-helix	186-191	6
β-strand	203-205	3	70
β-strand	208-212	5	70
β-strand	214-218	5	71
β-strand	224-227	4	72
β-strand	234-241	8	72
β-strand	253-259	7	72
β-strand	268-272	5	72
β-strand	280-281	2	72
α-helix	282-289	8
α-helix	294-301	8
α-helix	309-321	13
α-helix	327-336	10
α-helix	345-359	15
α-helix	371-389	19
α-helix	395-397	3
α-helix	401-403	3
β-strand	404-407	4	71
α-helix	409-437	29
α-helix	441-443	3
α-helix	444-447	4
α-helix	451-463	13
β-strand	466	1	73
β-strand	476	1	73
β-strand	480-482	3	70
α-helix	483-484	2
α-helix	488-494	7
β-strand	497-499	3	71
α-helix	516-518	3
β-strand	522	1	74
β-strand	536-538	3	71
β-strand	539	1	74
β-strand	544-545	2	75
α-helix	552-560	9
α-helix	563	1
β-strand	564-565	2	76
α-helix	566-568	3
α-helix	577	1
β-strand	578-582	5	76
β-strand	585-590	6	76
α-helix	593-605	13
β-strand	614-618	5	76
β-strand	623-627	5	76
β-strand	633-638	6	75
β-strand	640-643	4	77
β-strand	648-651	4	77
α-helix	655-667	13
α-helix	681-686	6
β-strand	690-694	5	75
α-helix	697-700	4
β-strand	703-704	2	78
α-helix	707-710	4
β-strand	740-741	2	78
α-helix	745-748	4
α-helix	759-761	3
α-helix	764-773	10
β-strand	792-796	5	28
β-strand	800	1	79
β-strand	804-805	2	80
α-helix	809-812	4
β-strand	821-827	7	81
β-strand	838-842	5	81
α-helix	843-847	5
β-strand	853-862	10	28
β-strand	873-874	2	82
β-strand	882-883	2	82
α-helix	890-892	3
β-strand	898	1	83
β-strand	904-905	2	28
β-strand	910	1	84
β-strand	912	1	83
β-strand	914-917	4	82
β-strand	934-936	3	82
β-strand	940	1	84
α-helix	941-942	2
β-strand	947-956	10	28
β-strand	962-972	11	28
β-strand	980-982	3	81
β-strand	987-994	8	81
β-strand	1001-1002	2	85
β-strand	1010-1012	3	81
α-helix	1014-1016	3
α-helix	1023-1038	16
α-helix	1041	1
β-strand	1042-1043	2	80
α-helix	1052-1060	9
β-strand	1069-1070	2	81
β-strand	1072-1073	2	85
β-strand	1080	1	85
β-strand	1085-1094	10	81
α-helix	1099-1101	3
β-strand	1104-1106	3	53
α-helix	1118-1119	2
β-strand	1128-1130	3	52
α-helix	1132-1141	10
β-strand	1143	1	67
α-helix	1144-1148	5
α-helix	1149-1153	5
β-strand	1158-1163	6	42
β-strand	1172-1174	3	86
β-strand	1179-1181	3	86
β-strand	1182	1	87
β-strand	1187	1	87
β-strand	1191-1196	6	42
α-helix	1198-1208	11
β-strand	1215-1218	4	43
α-helix	1219-1222	4

Chain C: 12 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	7-13	7	88
β-strand	17-23	7	88
α-helix	27-39	13
β-strand	43-54	12	89
α-helix	60-67	8
β-strand	72	1	90
α-helix	77-79	3
β-strand	97-104	8	89
β-strand	111-114	4	91
β-strand	119-120	2	89
α-helix	131	1
β-strand	132	1	90
α-helix	133	1
β-strand	143-147	5	91
β-strand	152-162	11	89
α-helix	168-170	3
β-strand	173-179	7	88
α-helix	197-200	4
α-helix	202-204	3
α-helix	205-209	5
α-helix	211-214	4
α-helix	218-219	2
β-strand	228-234	7	88
α-helix	240-270	31

Chain d: 8 helices, 0 β-strands

Element	Residues	Length
α-helix	32-39	8
α-helix	41-61	21
α-helix	67-88	22
α-helix	92-127	36
α-helix	132-147	16
α-helix	150-164	15
α-helix	185-190	6
α-helix	192-198	7

Chain D: 10 helices, 3 β-strands

Element	Residues	Length	Sheet
β-strand	36-38	3	92
β-strand	44-46	3	92
β-strand	49	1	7
α-helix	52-77	26
α-helix	111-114	4
α-helix	119-133	15
α-helix	139-150	12
α-helix	157-168	12
α-helix	174-182	9
α-helix	188-194	7
α-helix	196-198	3
α-helix	204-217	14
α-helix	219-220	2

Chain E: 13 helices, 14 β-strands

Element	Residues	Length	Sheet
α-helix	3-25	23
β-strand	28	1	93
α-helix	32-35	4
α-helix	39-45	7
β-strand	47	1	94
β-strand	53	1	94
α-helix	55-58	4
β-strand	60-62	3	95
β-strand	64	1	93
α-helix	66-71	6
β-strand	78-82	5	95
β-strand	87-88	2	96
α-helix	90-103	14
β-strand	107-112	6	95
β-strand	115-116	2	96
α-helix	118-121	4
α-helix	124-126	3
β-strand	131-136	6	95
α-helix	137-139	3
α-helix	144-146	3
β-strand	152-155	4	97
α-helix	158-168	11
α-helix	172-174	3
β-strand	177-178	2	97
α-helix	183-188	6
β-strand	195-202	8	97
β-strand	206-214	9	97

Chain f: 6 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	14-19	6
α-helix	27-32	6
α-helix	42-55	14
α-helix	89-96	8
α-helix	98-107	10
β-strand	113-121	9	26
β-strand	125-134	10	26
β-strand	146-156	11	26
β-strand	159-161	3	26
α-helix	166-191	26
β-strand	193-195	3	27
β-strand	199-201	3	27

25 more chain groups are not listed. Open the entry in the viewer and use the sequence panel to see them.

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Transcription initiation factor IIB	M	protein	345	Saccharomyces cerevisiae S288C	P29055 (AlphaFold model)
Transcription initiation factor IIF subunit alpha	P	protein	735	Saccharomyces cerevisiae S288C	P41895 (AlphaFold model)
Transcription initiation factor IIF subunit beta	Q	protein	400	Saccharomyces cerevisiae S288C	P41896 (AlphaFold model)
Transcription elongation factor S-II	S	protein	309	Saccharomyces cerevisiae S288C	P07273 (AlphaFold model)
Mediator of RNA polymerase II transcription subunit 1	a	protein	566	Saccharomyces cerevisiae S288C	Q12321
Mediator of RNA polymerase II transcription subunit 4	d	protein	284	Saccharomyces cerevisiae S288C	Q12343
Mediator of RNA polymerase II transcription subunit 6	f	protein	295	Saccharomyces cerevisiae S288C	P38782
Mediator of RNA polymerase II transcription subunit 7	g	protein	222	Saccharomyces cerevisiae S288C	Q08278
Mediator of RNA polymerase II transcription subunit 8	h	protein	223	Saccharomyces cerevisiae S288C	P38304
Mediator of RNA polymerase II transcription subunit 9	i	protein	149	Saccharomyces cerevisiae S288C	P33308
Mediator of RNA polymerase II transcription subunit 10	j	protein	157	Saccharomyces cerevisiae S288C	Q06213
Mediator of RNA polymerase II transcription subunit 11	k	protein	115	Saccharomyces cerevisiae S288C	Q99278

21 more molecules are not listed.

Sequence of entity 1 (M), FASTA

>7UI9_1 Transcription initiation factor IIB (chains M)
MMTRESIDKRAGRRGPNLNIVLTCPECKVYPPKIVERFSEGDVVCALCGLVLSDKLVDTR
SEWRTFSNDDHNGDDPSRVGEASNPLLDGNNLSTRIGKGETTDMRFTKELNKAQGKNVMD
KKDNEVQAAFAKITMLCDAAELPKIVKDCAKEAYKLCHDEKTLKGKSMESIMAASILIGC
RRAEVARTFKEIQSLIHVKTKEFGKTLNIMKNILRGKSEDGFLKIDTDNMSGAQNLTYIP
RFCSHLGLPMQVTTSAEYTAKKCKEIKEIAGKSPITIAVVSIYLNILLFQIPITAAKVGQ
TLQVTEGTIKSGYKILYEHRDKLVDPQLIANGVVSLDNLPGVEKK

Sequence of entity 2 (P), FASTA

>7UI9_2 Transcription initiation factor IIF subunit alpha (chains P)
MSRRNPPGSRNGGGPTNASPFIKRDRMRRNFLRMRMGQNGSNSSSPGVPNGDNSRGSLVK
KDDPEYAEEREKMLLQIGVEADAGRSNVKVKDEDPNEYNEFPLRAIPKEDLENMRTHLLK
FQSKKKINPVTDFHLPVRLHRKDTRNLQFQLTRAEIVQRQKEISEYKKKAEQERSTPNSG
GMNKSGTVSLNNTVKDGSQTPTVDSVTKDNTANGVNSSIPTVTGSSVPPASPTTVSAVES
NGLSNGSTSAANGLDGNASTANLANGRPLVTKLEDAGPAEDPTKVGMVKYDGKEVTNEPE
FEEGTMDPLADVAPDGGGRAKRGNLRRKTRQLKVLDENAKKLRFEEFYPWVMEDFDGYNT
WVGSYEAGNSDSYVLLSVEDDGSFTMIPADKVYKFTARNKYATLTIDEAEKRMDKKSGEV
PRWLMKHLDNIGTTTTRYDRTRRKLKAVADQQAMDEDDRDDNSEVELDYDEEFADDEEAP
IIDGNEQENKESEQRIKKEMLQANAMGLRDEEAPSENEEDELFGEKKIDEDGERIKKALQ
KTELAALYSSDENEINPYLSESDIENKENESPVKKEEDSDTLSKSKRSSPKKQQKKATNA
HVHKEPTLRVKSIKNCVIILKGDKKILKSFPEGEWNPQTTKAVDSSNNASNTVPSPIKQE
EGLNSTVAEREETPAPTITEKDIIEAIGDGKVNIKEFGKFIRRKYPGAENKKLMFAIVKK
LCRKVGNDHMELKKE

Sequence of entity 3 (Q), FASTA

>7UI9_3 Transcription initiation factor IIF subunit beta (chains Q)
MSSGSAGAPALSNNSTNSVAKEKSGNISGDEYLSQEEEVFDGNDIENNETKVYEESLDLD
LERSNRQVWLVRLPMFLAEKWRDRNNLHGQELGKIRINKDGSKITLLLNENDNDSIPHEY
DLELTKKVVENEYVFTEQNLKKYQQRKKELEADPEKQRQAYLKKQEREEELKKKQQQQKR
RNNRKKFNHRVMTDRDGRDRYIPYVKTIPKKTAIVGTVCHECQVMPSMNDPNYHKIVEQR
RNIVKLNNKERITTLDETVGVTMSHTGMSMRSDNSNFLKVGREKAKSNIKSIRMPKKEIL
DYLFKLFDEYDYWSLKGLKERTRQPEAHLKECLDKVATLVKKGPYAFKYTLRPEYKKLKE
EERKATLGELADEQTGSAGDNAQGDAEADLEDEIEMEDVV

Sequence of entity 4 (S), FASTA

>7UI9_4 Transcription elongation factor S-II (chains S)
MDSKEVLVHVKNLEKNKSNDAAVLEILHVLDKEFVPTEKLLRETKVGVEVNKFKKSTNVE
ISKLVKKMISSWKDAINKNKRSRQAQQHHQDHAPGNAEDKTTVGESVNGVQQPASSQSDA
MKQDKYVSTKPRNSKNDGVDTAIYHHKLRDQVLKALYDVLAKESEHPPQSILHTAKAIES
EMNKVNNCDTNEAAYKARYRIIYSNVISKNNPDLKHKIANGDITPEFLATCDAKDLAPAP
LKQKIEEIAKQNLYNAQGATIERSVTDRFTCGKCKEKKVSYYQLQTRSADEPLTTFCTCE
ACGNRWKFS

Sequence of entity 5 (a), FASTA

>7UI9_5 Mediator of RNA polymerase II transcription subunit 1 (chains a)
MVEGDSYVETLDSMIELFKDYKPGSITLENITRLCQTLGLESFTEELSNELSRLSTASKI
IVIDVDYNKKQDRIQDVKLVLASNFDNFDYFNQRDGEHEKSNILLNSLTKYPDLKAFHNN
LKFLYLLDAYSHIESDSTSHNNGSSDKSLDSSNASFNNQGKLDLFKYFTELSHYIRQCFQ
DNCCDFKVRTNLNDKFGIYILTQGINGKEVPLAKIYLEENKSDSQYRFYEYIYSQETKSW
INESAENFSNGISLVMEIVANAKESNYTDLIWFPEDFISPELIIDKVTCSSNSSSSPPII
DLFSNNNYNSRIQLMNDFTTKLINIKKFDISNDNLDLISEILKWVQWSRIVLQNVFKLVS
TPSSNSNSSELEPDYQAPFSTSTKDKNSSTSNTEPIPRSNRHGSVVEASRRRRSSTNKSK
RPSITEAMMLKEEGLQQFNLHEILSEPAIEEENGDSIKEHSTTMDGANDLGFTASVSNQE
NAGTDIVMEDHGVLQGTSQNYGTATADDADIEMKDVSSKPSKPESSVLQLIVSEDHIILD
TISECNLYDDVKCWSKFIEKFQDIVS

Sequence of entity 6 (d), FASTA

>7UI9_6 Mediator of RNA polymerase II transcription subunit 4 (chains d)
MSVQDTKAVEFSMGHIRSSSVSLVAEATSNTNSEDKLSKVQLYEDLCRYEDTLSKLVESV
DRFKPNLDIAKDLIRTDEALFENVKLLAEYDNIYRNLQKIDKDSEELDSKTRKILEILNE
CHDELKALPMLEQVEFEKNTILQQRSKINSTELLDYATKLSKFTKIPPTFDKGAVGPNNF
IWPAEDALRRGMLAMASLHSKELTRIPGEEVEETEVPTVPPSQSEEQKGQMAKKEGTPKT
DSFIFDGTAKEVGDEADNTKDKEKEENNDDALDLDLDLFDPDDF

Sequence of entity 7 (f), FASTA

>7UI9_7 Mediator of RNA polymerase II transcription subunit 6 (chains f)
MNVTPLDELQWKSPEWIQVFGLRTENVLDYFAESPFFDKTSNNQVIKMQRQFSQLNDPNA
AVNMTQNIMTLPDGKNGNLEEEFAYVDPARRQILFKYPMYMQLEEELMKLDGTEYVLSSV
REPDFWVIRKQRRTNNSGVGSAKGPEIIPLQDYYIIGANIYQSPTIFKIVQSRLMSTSYH
LNSTLESLYDLIEFQPSQGVHYKVPTDTSTTATAATNGNNAGGGSNKSSVRPTGGANMAT
VPSTTNVNMTVNTMGTGGQTIDNGTGRTGNGNMGITTEMLDKLMVTSIRSTPNYI

Sequence of entity 8 (g), FASTA

>7UI9_8 Mediator of RNA polymerase II transcription subunit 7 (chains g)
MSNDPGNEVSSLYPPPPPYVKFFTQSNLEKLPKYKEKKAASAKQTAPNNSNGGSEEEITC
ALDYLIPPPMPKNQQYRAFGSIWQVKDQLPDLESMGLTQLYKKSTENESTNYQYKIQELR
KLLKSLLLNYLELIGVLSINPDMYERKVENIRTILVNIHHLLNEYRPHQSRESLIMLLEE
QLEYKRGEIREIEQVCKQVHDKLTSIQDTLRTGSQSPPSSSQ

Sequence of entity 9 (h), FASTA

>7UI9_9 Mediator of RNA polymerase II transcription subunit 8 (chains h)
MSQSTASLVPEGNQGSLQEDVSFDFNGVPGQALDAVRMRLAQLTHSLRRIRDEMSKAELP
QWYTLQSQLNVTLSQLVSVTSTLQHFQETLDSTVVYPLPKFPTTSHESLVTTLLRKKNIP
EVDEWMKYVRETSGVTTALLKDEEIEKLLQQDREITNWARTTFRNEYGKHDFKNEESLSE
EHASLLVRDSKPSKPFNVDDVLKFTFTGEKPIITGSTSTSSSN

Sequence of entity 10 (i), FASTA

>7UI9_10 Mediator of RNA polymerase II transcription subunit 9 (chains i)
MNLQNNVLNQIHQILLPTNPTLDKPNAEATKEEFSSAENRDEKDYLTNQQPKNLSTPSTS
SNGEFIPHIFYSLHQIRKDPNNLSNQLETLTGSIRHRLKLCKSLISENEDTKDLLSKSPS
EWQDIIHQREQELQIKRDVLDDLYRKLQR

Sequence of entity 11 (j), FASTA

>7UI9_11 Mediator of RNA polymerase II transcription subunit 10 (chains j)
MNGNSTNNEQLQQELATTQDQVASIIESFVELGVSIYDFPGTPEATKGMITNLQRNVDRL
YKLNVRSNDPQSSLSKVDIPLEVVQYIEDGRNPDIYTREFVEAIRRSNQYQRGKMHGLKQ
LRDSLADKIVDEFPELKEPVEDIIKRTSPIDNVSNTH

Sequence of entity 12 (k), FASTA

>7UI9_12 Mediator of RNA polymerase II transcription subunit 11 (chains k)
MQPPYIQERLKSLNDIETQLCSMLQEASQVTFIFGELKRGNESVKPQFENHVKQFYERLD
KSTTQLRKEIQLLDENVGTRLLPINVNKKALGQDTEKMEEQLDLLSAILDPSKSK

Primary citation

Structural basis of a transcription pre-initiation complex on a divergent promoter. Gorbea Colon, J.J., Palao 3rd, L., Chen, S.F. et al. Mol Cell (2023) 83:574. DOI 10.1016/j.molcel.2023.01.011 · PubMed

Other PDB entries of the same protein (UniProt P29055 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7O4J 2.9 Å, Yeast RNA polymerase II transcription pre-initiation complex (consensus)
7ML0 3.0 Å, RNA polymerase II pre-initiation complex (PIC1)
8CEN 3.0 Å, Yeast RNA polymerase II transcription pre-initiation complex with core Mediator
7ML4 3.1 Å, RNA polymerase II initially transcribing complex (ITC)
7ZS9 3.1 Å, Yeast RNA polymerase II transcription pre-initiation complex with the +1 nucleosome…
7O4I 3.2 Å, Yeast RNA polymerase II transcription pre-initiation complex with initial transcription…
7O75 3.2 Å, Yeast RNA polymerase II transcription pre-initiation complex with open promoter DNA
7UIO 3.3 Å, Mediator-PIC Early (Composite Model)
4BBR 3.4 Å, Structure of RNA polymerase II-TFIIB complex
7ML2 3.4 Å, RNA polymerase II pre-initiation complex (PIC3)
7O72 3.4 Å, Yeast RNA polymerase II transcription pre-initiation complex with closed promoter DNA
7O73 3.4 Å, Yeast RNA polymerase II transcription pre-initiation complex with closed distorted…

Browse structure collections

About this viewer

MolViewer shows 7UI9 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.