Cocrystal structure of human CaMKII-alpha (CAMK2A)kinase domain and GluN2B(S1303D) in complex with ATP. Determined by X-ray diffraction at 2.1 Å resolution. Released 13 Apr 2022.
Explore 7UJT in 3D Show helices and sheets RCSB PDB PDBe
7UJT contains 16 α-helices and 15 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 8-12 | 5 | |
| β-strand | 13-21 | 9 | 1 |
| β-strand | 25-32 | 8 | 1 |
| β-strand | 37-45 | 9 | 1 |
| α-helix | 46-48 | 3 | |
| α-helix | 51-65 | 15 | |
| β-strand | 72 | 1 | 2 |
| β-strand | 75-81 | 7 | 1 |
| β-strand | 84-89 | 6 | 1 |
| β-strand | 96 | 1 | 2 |
| α-helix | 97-104 | 8 | |
| α-helix | 109-128 | 20 | |
| β-strand | 131-132 | 2 | 3 |
| α-helix | 138-140 | 3 | |
| β-strand | 141-143 | 3 | 2 |
| α-helix | 150-151 | 2 | |
| β-strand | 152-154 | 3 | 2 |
| β-strand | 161-162 | 2 | 3 |
| β-strand | 169 | 1 | 4 |
| β-strand | 175 | 1 | 5 |
| α-helix | 177-179 | 3 | |
| α-helix | 182-185 | 4 | |
| β-strand | 190 | 1 | 4 |
| α-helix | 193-208 | 16 | |
| α-helix | 218-226 | 9 | |
| α-helix | 242-251 | 10 | |
| α-helix | 256-258 | 3 | |
| α-helix | 260-261 | 2 | |
| α-helix | 262-267 | 6 | |
| α-helix | 269-272 | 4 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 1304 | 1 | 5 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Calcium/calmodulin-dependent protein kinase type II subunit alpha | A | protein | 268 | Homo sapiens | Q9UQM7 (AlphaFold model) |
| Glutamate receptor ionotropic, NMDA 2B | B | protein | 22 | Homo sapiens | Q13224 (AlphaFold model) |
>7UJT_1 Calcium/calmodulin-dependent protein kinase type II subunit alpha (chains A) TRFTEEYQLFEELGKGAFSVVRRCVKVLAGQEYAAKIINTKKLSARDHQKLEREARICRL LKHPNIVRLHDSISEEGHHYLIFDLVTGGELFEDIVAREYYSEADASHCIQQILEAVLHC HQMGVVHRNLKPENLLLASKLKGAAVKLADFGLAIEVEGEQQAWFGFAGTPGYLSPEVLR KDPYGKPVDLWACGVILYILLVGYPPFWDEDQHRLYKQIKAGAYDFPSPEWDTVTPEAKD LINKMLTINPSKRITAAEALKHPWISHR
>7UJT_2 Glutamate receptor ionotropic, NMDA 2B (chains B) KAQKKNRNKLRRQHDYDTFVDL
Water and common crystallization additives (GOL) are not listed.
CaMKII binds both substrates and activators at the active site. Ozden, C., Sloutsky, R., Mitsugi, T. et al. Cell Rep (2022) 40:111064-111064. DOI 10.1016/j.celrep.2022.111064 · PubMed
Other PDB entries of the same protein (UniProt Q9UQM7 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 7UJT directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.