Crystal structure of mouse CRY2 in complex with SHP1703 compound. Determined by X-ray diffraction at 1.9 Å resolution. Released 24 Aug 2022.
Explore 7V8Y in 3D Show helices and sheets RCSB PDB PDBe
7V8Y contains 38 α-helices and 10 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 21-27 | 7 | 1 |
| α-helix | 37-43 | 7 | |
| β-strand | 46-55 | 10 | 1 |
| α-helix | 59-61 | 3 | |
| α-helix | 67-85 | 19 | |
| β-strand | 91-95 | 5 | 1 |
| α-helix | 98-109 | 12 | |
| β-strand | 113-117 | 5 | 1 |
| α-helix | 122-137 | 16 | |
| β-strand | 141-145 | 5 | 1 |
| α-helix | 153-159 | 7 | |
| α-helix | 168-176 | 9 | |
| α-helix | 179-189 | 11 | |
| α-helix | 190-195 | 6 | |
| β-strand | 197 | 1 | 1 |
| α-helix | 198-201 | 4 | |
| α-helix | 204-206 | 3 | |
| α-helix | 209-212 | 4 | |
| α-helix | 213-216 | 4 | |
| α-helix | 218-221 | 4 | |
| α-helix | 225-226 | 2 | |
| α-helix | 232-242 | 11 | |
| α-helix | 245-247 | 3 | |
| α-helix | 248 | 1 | |
| α-helix | 249-253 | 5 | |
| α-helix | 260-262 | 3 | |
| α-helix | 264-265 | 2 | |
| α-helix | 270-275 | 6 | |
| α-helix | 280-295 | 16 | |
| α-helix | 302-305 | 4 | |
| α-helix | 306-318 | 13 | |
| β-strand | 339 | 1 | 2 |
| α-helix | 342-350 | 9 | |
| α-helix | 356-368 | 13 | |
| α-helix | 373-383 | 11 | |
| β-strand | 390 | 1 | 2 |
| α-helix | 392-402 | 11 | |
| α-helix | 408-418 | 11 | |
| α-helix | 429-432 | 4 | |
| α-helix | 435-440 | 6 | |
| α-helix | 445-450 | 6 | |
| α-helix | 452-454 | 3 | |
| α-helix | 465-467 | 3 | |
| α-helix | 470-475 | 6 | |
| β-strand | 480 | 1 | 3 |
| β-strand | 484 | 1 | 3 |
| α-helix | 485-487 | 3 | |
| α-helix | 491-507 | 17 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Cryptochrome-2 | A | protein | 514 | Mus musculus | Q9R194 (AlphaFold model) |
>7V8Y_1 Cryptochrome-2 (chains A) GTMAAAAVVAATVPAQSMGADGASSVHWFRKGLRLHDNPALLAAVRGARCVRCVYILDPW FAASSSVGINRWRFLLQSLEDLDTSLRKLNSRLFVVRGQPADVFPRLFKEWGVTRLTFEY DSEPFGKERDAAIMKMAKEAGVEVVTENSHTLYDLDRIIELNGQKPPLTYKRFQALISRM ELPKKPAVAVSSQQMESCRAEIQENHDDTYGVPSLEELGFPTEGLGPAVWQGGETEALAR LDKHLERKAWVANYERPRMNANSLLASPTGLSPYLRFGCLSCRLFYYRLWDLYKKVKRNS TPPLSLFGQLLWREFFYTAATNNPRFDRMEGNPICIQIPWDRNPEALAKWAEGKTGFPWI DAIMTQLRQEGWIHHLARHAVACFLTRGDLWVSWESGVRVFDELLLDADFSVNAGSWMWL SCSAFFQQFFHCYCPVGFGRRTDPSGDYIRRYLPKLKGFPSRYIYEPWNAPESVQKAAKC IIGVDYPRPIVNHAETSRLNIERMKQIYQQLSRY
| ID | Name | Formula | Copies |
|---|---|---|---|
| 5YH | 1-[(2R)-3-[3,6-bis(fluoranyl)carbazol-9-yl]-2-oxidanyl-propyl]imidazolidin-2-one | C18 H17 F2 N3 O2 | 1 |
CRY2 isoform selectivity of a circadian clock modulator with antiglioblastoma efficacy. Miller, S., Kesherwani, M., Chan, P. et al. Proc Natl Acad Sci U S A (2022) 119:e2203936119-e2203936119. DOI 10.1073/pnas.2203936119 · PubMed
Other PDB entries of the same protein (UniProt Q9R194 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 7V8Y directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.