7V8Z: Mouse CRY2

Crystal structure of mouse CRY2 in complex with SHP656 compound. Determined by X-ray diffraction at 1.95 Å resolution. Released 24 Aug 2022.

Method: X-ray diffraction
Resolution: 1.95 Å
Organism: Mus musculus
Chains: 1
Atoms: 4,071
Mol. weight: 59.19 kDa
Ligands: 5YH
Released: 24 Aug 2022

Explore 7V8Z in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7V8Z contains 39 α-helices and 10 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 39 helices, 10 β-strands

Element	Residues	Length	Sheet
β-strand	21-27	7	1
α-helix	37-43	7
β-strand	46-55	10	1
α-helix	59-62	4
α-helix	67-86	20
β-strand	91-95	5	1
α-helix	98-109	12
β-strand	113-117	5	1
α-helix	122-137	16
β-strand	141-145	5	1
α-helix	153-159	7
α-helix	168-176	9
α-helix	179-189	11
α-helix	190-195	6
β-strand	197	1	1
α-helix	198-201	4
α-helix	204-206	3
α-helix	209-212	4
α-helix	213-216	4
α-helix	218-221	4
α-helix	225-226	2
α-helix	232-242	11
α-helix	245-247	3
α-helix	248	1
α-helix	249-253	5
α-helix	260-262	3
α-helix	264-265	2
α-helix	270-275	6
α-helix	280-295	16
α-helix	302-305	4
α-helix	306-318	13
β-strand	339	1	2
α-helix	342-350	9
α-helix	356-368	13
α-helix	373-381	9
α-helix	382-386	5
β-strand	390	1	2
α-helix	392-402	11
α-helix	408-418	11
α-helix	429-432	4
α-helix	435-440	6
α-helix	445-450	6
α-helix	452-454	3
α-helix	465-467	3
α-helix	470-475	6
β-strand	480	1	3
β-strand	484	1	3
α-helix	485-487	3
α-helix	491-507	17

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Cryptochrome-2	A	protein	514	Mus musculus	Q9R194 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>7V8Z_1 Cryptochrome-2 (chains A)
GTMAAAAVVAATVPAQSMGADGASSVHWFRKGLRLHDNPALLAAVRGARCVRCVYILDPW
FAASSSVGINRWRFLLQSLEDLDTSLRKLNSRLFVVRGQPADVFPRLFKEWGVTRLTFEY
DSEPFGKERDAAIMKMAKEAGVEVVTENSHTLYDLDRIIELNGQKPPLTYKRFQALISRM
ELPKKPAVAVSSQQMESCRAEIQENHDDTYGVPSLEELGFPTEGLGPAVWQGGETEALAR
LDKHLERKAWVANYERPRMNANSLLASPTGLSPYLRFGCLSCRLFYYRLWDLYKKVKRNS
TPPLSLFGQLLWREFFYTAATNNPRFDRMEGNPICIQIPWDRNPEALAKWAEGKTGFPWI
DAIMTQLRQEGWIHHLARHAVACFLTRGDLWVSWESGVRVFDELLLDADFSVNAGSWMWL
SCSAFFQQFFHCYCPVGFGRRTDPSGDYIRRYLPKLKGFPSRYIYEPWNAPESVQKAAKC
IIGVDYPRPIVNHAETSRLNIERMKQIYQQLSRY

Ligands and cofactors

ID	Name	Formula	Copies
5YH	1-[(2R)-3-[3,6-bis(fluoranyl)carbazol-9-yl]-2-oxidanyl-propyl]imidazolidin-2-one	C18 H17 F2 N3 O2	1

Primary citation

CRY2 isoform selectivity of a circadian clock modulator with antiglioblastoma efficacy. Miller, S., Kesherwani, M., Chan, P. et al. Proc Natl Acad Sci U S A (2022) 119:e2203936119-e2203936119. DOI 10.1073/pnas.2203936119 · PubMed

Other PDB entries of the same protein (UniProt Q9R194 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7V8Y 1.9 Å, Crystal structure of mouse CRY2 in complex with SHP1703 compound
4MLP 1.94 Å, Mammalian cryptochrome in complex with a small molecule competitor of its ubiquitin ligase
4I6G 2.2 Å, a vertebrate cryptochrome with FAD
6KX8 2.25 Å, Crystal structure of mouse Cryptochrome 2 in complex with TH301 compound
7EJ9 2.6 Å, Alternative crystal structure of mouse Cryptochrome 2 in complex with TH301 compound
4I6E 2.7 Å, A vertebrate cryptochrome
4I6J 2.7 Å, A ubiquitin ligase-substrate complex
4U8H 2.8 Å, Crystal Structure of Mammalian Period-Cryptochrome Complex
7D0N 2.8 Å, Crystal structure of mouse CRY2 apo form

Browse structure collections

About this viewer

MolViewer shows 7V8Z directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.