Cryo-EM structure of pseudoallergen receptor MRGPRX2 complex with linear cortistatin-14, local. Determined by electron microscopy at 2.97 Å resolution. Released 1 Dec 2021.
Explore 7VV4 in 3D Show helices and sheets RCSB PDB PDBe
7VV4 contains 19 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 28-53 | 26 | |
| α-helix | 54-58 | 5 | |
| α-helix | 65-90 | 26 | |
| α-helix | 91-95 | 5 | |
| α-helix | 105-132 | 28 | |
| α-helix | 134-135 | 2 | |
| α-helix | 136-140 | 5 | |
| α-helix | 145-167 | 23 | |
| α-helix | 177-212 | 36 | |
| α-helix | 218-231 | 14 | |
| α-helix | 232-236 | 5 | |
| α-helix | 237-240 | 4 | |
| α-helix | 241-246 | 6 | |
| α-helix | 247-250 | 4 | |
| α-helix | 253-255 | 3 | |
| α-helix | 256-260 | 5 | |
| α-helix | 261-276 | 16 | |
| α-helix | 277-281 | 5 | |
| α-helix | 282-284 | 3 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Mas-related G-protein coupled receptor member X2 | R | protein | 330 | Homo sapiens | Q96LB1 (AlphaFold model) |
| circular cortistatin-14 | L | protein | 14 | Homo sapiens | O00230 (AlphaFold model) |
>7VV4_1 Mas-related G-protein coupled receptor member X2 (chains R) MDPTTPAWGTESTTVNGNDQALLLLCGKETLIPVFLILFIALVGLVGNGFVLWLLGFRMR RNAFSVYVLSLAGADFLFLCFQIINCLVYLSNFFCSISINFPSFFTTVMTCAYLAGLSML STVSTERCLSVLWPIWYRCRRPRHLSAVVCVLLWALSLLLSILEGKFCGFLFSDGDSGWC QTFDFITAAWLIFLFMVLCGSSLALLVRILCGSRGLPLTRLYLTILLTVLVFLLCGLPFG IQWFLILWIWKDSDVLFCHIHPVSVVLSSLNSSANPIIYFFVGSFRKQWRLQQPILKLAL QRALQDIAEVDHSEGCFRQGTPEMSRSSLV
>7VV4_2 circular cortistatin-14 (chains L) PCKNFFWKTFSSCK
| ID | Name | Formula | Copies |
|---|---|---|---|
| CLR | Cholesterol | C27 H46 O | 1 |
Structure, function and pharmacology of human itch receptor complexes. Yang, F., Guo, L., Li, Y. et al. Nature (2021) 600:164-169. DOI 10.1038/s41586-021-04077-y · PubMed
Other PDB entries of the same protein (UniProt Q96LB1 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 7VV4 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.