7W36: Human Atg5

Crystal structure of human Atg5 complexed with a stapled peptide. Determined by X-ray diffraction at 3.0 Å resolution. Released 21 Sept 2022.

Method: X-ray diffraction
Resolution: 3.0 Å
Organism: Homo sapiens
Chains: 2
Atoms: 2,352
Mol. weight: 35.31 kDa
Released: 21 Sept 2022

Explore 7W36 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7W36 contains 19 α-helices and 17 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 17 helices, 17 β-strands

Element	Residues	Length	Sheet
α-helix	4-12	9
β-strand	15-22	8	1
α-helix	23-27	5
β-strand	35-40	6	1
α-helix	46-48	3
α-helix	50-57	8
β-strand	69-71	3	1
β-strand	76	1	1
α-helix	83-91	9
α-helix	95	1
β-strand	98-103	6	1
α-helix	113-116	4
α-helix	118-137	20
α-helix	140-144	5
α-helix	147-158	12
α-helix	162-172	11
β-strand	187-190	4	2
α-helix	197-198	2
β-strand	199	1	2
β-strand	206	1	3
α-helix	211	1
β-strand	212	1	3
α-helix	213	1
β-strand	214	1	4
α-helix	215-222	8
α-helix	224-226	3
β-strand	227	1	5
β-strand	234	1	5
β-strand	237-239	3	2
β-strand	240	1	6
β-strand	243	1	6
β-strand	250	1	4
α-helix	251-258	8
β-strand	265-270	6	2

Chain B: 2 helices, 0 β-strands

Element	Residues	Length	Sheet
α-helix	3-14	12
α-helix	15-19	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Autophagy protein 5	A	protein	275	Homo sapiens	Q9H1Y0 (AlphaFold model)
Stapled ATG16L1-derived peptide	B	protein	23	Homo sapiens	Q676U5 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>7W36_1 Autophagy protein 5 (chains A)
MTDDKDVLRDVWFGRIPTCFTLYQDEITEREAEPYYLLLPRVSYLTLVTDKVKKHFQKVM
RQEDISEIWFEYEGTPLKWHYPIGLLFDLLASSSALPWNITVHFKSFPEKDLLHCPSKDA
IEAHFMSCMKEADALKHKSQVINEMQKKDHKQLWMGLQNDRFDQFWAINRKLMEYPAEEN
GFRYIPFRIYQTTTERPFIQKLFRPVAADGQLHTLGDLLKEVCPSAIDPEDGEKKNQVMI
HGIEPMLETPLQWLSEHLSYPDNFLHISIIPQPTD

Sequence of entity 2 (B), FASTA

>7W36_2 Stapled ATG16L1-derived peptide (chains B)
XWKRHISEQLRLRDRLQRQAFEX

Primary citation

Targeting the ATG5-ATG16L1 Protein-Protein Interaction with a Hydrocarbon-Stapled Peptide Derived from ATG16L1 for Autophagy Inhibition. Cui, J., Ogasawara, Y., Kurata, I. et al. J Am Chem Soc (2022) 144:17671-17679. DOI 10.1021/jacs.2c07648 · PubMed

Other PDB entries of the same protein (UniProt Q9H1Y0 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4TQ1 1.8 Å, Crystal structure of human ATG5-TECAIR
4NAW 2.19 Å, Crystal Structure of Human ATG12~ATG5-ATG16N in complex with a fragment of ATG3
4TQ0 2.7 Å, Crystal structure of human ATG5-ATG16N69
4GDK 2.7 Å, Crystal Structure of Human Atg12~Atg5 Conjugate in Complex with an N-terminal Fragment…
4GDL 2.88 Å, Crystal Structure of Human Atg12~Atg5 Conjugate in Complex with an N-terminal Fragment…
5D7G 3.0 Å, Structure of human ATG5 E122D-ATG16L1 complex at 3.0 Angstroms
5NPV 3.1 Å, Structure of human ATG5-ATG16L1(ATG5BD) complex (I4)
5NPW 3.1 Å, Structure of human ATG5-ATG16L1(ATG5BD) complex (C2)

Browse structure collections

About this viewer

MolViewer shows 7W36 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.