7XN9: SSTR2 and L-054,522 complex

Crystal structure of SSTR2 and L-054,522 complex. Determined by X-ray diffraction at 2.6 Å resolution. Released 3 Aug 2022.

Method: X-ray diffraction
Resolution: 2.6 Å
Organisms: Homo sapiens, Niallia circulans
Chains: 1
Atoms: 3,787
Mol. weight: 66.94 kDa
Ligands: GI9
Released: 3 Aug 2022

Explore 7XN9 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7XN9 contains 17 α-helices and 15 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 17 helices, 15 β-strands

Element	Residues	Length	Sheet
α-helix	40-70	31
α-helix	72-74	3
α-helix	77-105	29
α-helix	111-145	35
α-helix	149-151	3
α-helix	156-173	18
α-helix	175-180	6
β-strand	181-185	5	1
β-strand	191-195	5	1
α-helix	196-197	2
α-helix	198-200	3
α-helix	202-213	12
α-helix	214-218	5
α-helix	219-237	19
β-strand	1004-1009	6	2
β-strand	1014-1018	5	3
β-strand	1024-1030	7	3
β-strand	1035-1041	7	2
β-strand	1049-1060	12	3
β-strand	1063-1072	10	2
β-strand	1076-1084	9	2
β-strand	1095-1099	5	2
β-strand	1102-1114	13	2
β-strand	1122-1131	10	2
α-helix	1134-1136	3
β-strand	1141-1144	4	3
α-helix	1145-1154	10
β-strand	1162-1172	11	2
β-strand	1176-1184	9	3
α-helix	249-280	32
α-helix	288-315	28
α-helix	317-327	11

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Somatostatin receptor type 2,Endo-1,4-beta-xylanase	A	protein	589	Homo sapiens, Niallia circulans	P09850 (AlphaFold model), P30874 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>7XN9_1 Somatostatin receptor type 2,Endo-1,4-beta-xylanase (chains A)
MKTIIALSYIFCLVFADYKDDDDGAPDMADEPLNGSHTWLSIPFDLNGSVVSTNTSNQTE
PYYDLTSNAVLTFIYFVVCIIGLCGNTLVIYVILRYAKMKTITNIYILNLAIADELFMLG
LPFLAMQVALEHWPFGKAICRVVMTVDGINQFTSIFCLTVMSIDRYLAVVHPIKSAKWRR
PRTAKMITMAVWGVSLLVILPIMIYAGLRSNQWGRSSCTINWPGESGAWYTGFIIYTFIL
GFLVPLTIICLCYLFIIIKVKSSGASTDYWQNWTFGGGIVNAVNGSGGNYSVNWSNTGNF
VVGKGWTTGSPFRTINYNAGVWAPNGNGYLTLYGWTRSPLIEYYVVDSWGTYRPTGTYKG
TVKSDGGTYDIYTTTRYNAPSIDGDDTTFTQYWSVRQSKRPTGSNATITFTNHVNAWKSH
GMNLGSNWAYQVMATEGYQSSGSSNVTVWGSSKRKKSEKKVTRMVSIVVAVFIFCWLPFY
IFNVSSVSMAISPTPALKGMFDFVVVLTYANSCANPILYAFLDDNFKKSFQNVLCLVKVS
GTDDGERSDSKQDKSRLNETTETQRTEFLEVLFQGPHHHHHHHHHHEPE

Ligands and cofactors

ID	Name	Formula	Copies
GI9	tert-butyl (2S)-6-azanyl-2-[[(2R,3S)-3-(1H-indol-3-yl)-2-[[4-(2-oxidanylidene-3…	C35 H47 N7 O5	1

Water and common crystallization additives (EPE) are not listed.

Primary citation

Structural insights into ligand recognition and selectivity of somatostatin receptors. Zhao, W., Han, S., Qiu, N. et al. Cell Res (2022) 32:761-772. DOI 10.1038/s41422-022-00679-x · PubMed

Other PDB entries of the same protein (UniProt P09850 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8QY3 1.24 Å, Xylanase from Bacillus circulans mutant E78Q/F125A bound to xylotriose
8R85 1.3 Å, Xylanase from Bacillus circulans mutant E78Q/W9A
8QXY 1.41 Å, Xylanase from Bacillus circulans mutant E78Q bound to xylotriose
1XNB 1.49 Å, High-resolution structures of xylanases from B. Circulans and T. Harzianum identify a…
2BVV 1.5 Å, Sugar ring distortion in the glycosyl-enzyme intermediate of a family G/11 xylanase.
8QXZ 1.5 Å, Xylanase from Bacillus circulans mutant E78Q/Y69A
8R86 1.5 Å, Xylanase from Bacillus circulans mutant E78Q/W71A
1C5H 1.55 Å, Hydrogen bonding and catalysis: an unexpected explanation for how a single amino acid…
3VZK 1.55 Å, Crystal structure of the Bacillus circulans endo-beta-(1,4)-xylanase (BcX) N35E mutant
1HV0 1.6 Å, Dissecting electrostatic interactions and the PH-dependent activity of a family 11…
1XNC 1.6 Å, Thermostabilization of the bacillus circulans xylanase, by the introduction of disulfide…
3VZN 1.67 Å, Crystal structure of the Bacillus circulans endo-beta-(1,4)-xylanase (BcX) N35E mutant…

Browse structure collections

About this viewer

MolViewer shows 7XN9 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.