7XNA: PDB entry 7XNA

Crystal structure of somatostatin receptor 2 (SSTR2) with peptide antagonist CYN 154806. Determined by X-ray diffraction at 2.65 Å resolution. Released 3 Aug 2022.

Method: X-ray diffraction
Resolution: 2.65 Å
Organisms: Homo sapiens, Niallia circulans, synthetic construct
Chains: 2
Atoms: 3,778
Mol. weight: 66.68 kDa
Released: 3 Aug 2022

Explore 7XNA in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7XNA contains 17 α-helices and 15 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 17 helices, 15 β-strands

Element	Residues	Length	Sheet
α-helix	42-70	29
α-helix	77-105	29
α-helix	112-145	34
α-helix	156-173	18
α-helix	175-179	5
β-strand	181-185	5	1
β-strand	191-195	5	1
α-helix	203-213	11
α-helix	214-218	5
α-helix	219-236	18
β-strand	1004-1010	7	2
β-strand	1013-1019	7	3
β-strand	1024-1031	8	3
β-strand	1034-1041	8	2
α-helix	1048	1
β-strand	1049-1060	12	3
β-strand	1063-1072	10	2
β-strand	1076-1084	9	2
β-strand	1092-1099	8	2
β-strand	1102-1114	13	2
β-strand	1122-1131	10	2
α-helix	1134-1136	3
β-strand	1141-1144	4	3
α-helix	1145-1154	10
β-strand	1162-1173	12	2
β-strand	1176-1184	9	3
α-helix	246-248	3
α-helix	249-281	33
α-helix	285-287	3
α-helix	288-304	17
α-helix	308-315	8
α-helix	317-326	10

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Somatostatin receptor type 2,Endo-1,4-beta-xylanase	A	protein	583	Homo sapiens, Niallia circulans	P09850 (AlphaFold model), P30874 (AlphaFold model)
CYN 154806	B	protein	10	synthetic construct

Sequence of entity 1 (A), FASTA

>7XNA_1 Somatostatin receptor type 2,Endo-1,4-beta-xylanase (chains A)
MKTIIALSYIFCLVFADYKDDDDGAPDMADEPLNGSHTWLSIPFDLNGSVVSTNTSNQTE
PYYDLTSNAVLTFIYFVVCIIGLCGNTLVIYVILRYAKMKTITNIYILNLAIANELFMLG
LPFLAMQVALEHWPFGKAICRVVMTVDGINQFTSIFCLTVMSIDRYLAVVHPIKSAKWRR
PRTAKMITMAVWGVSLLVILPIMIYAGLRSNQWGRSSCTINWPGESGAWYTGFIIYTFIL
GFLVPLTIICLCYLFIIIKVKSASTDYWQNWTFGGGIVNAVNGSGGNYSVNWSNTGNFVV
GKGWTTGSPFRTINYNAGVWAPNGNGYLTLYGWTRSPLIEYYVVDSWGTYRPTGTYKGTV
KSDGGTYDIYTTTRYNAPSIDGDDTTFTQYWSVRQSKRPTGSNATITFTNHVNAWKSHGM
NLGSNWAYQVMATEGYQSSGSSNVTVWSSKRKKSEKKVTRMVSIVVAVFIFCWLPFYIFN
VSSVSMAISPTPALKGMFDFVVVLTYANSCANPILYAFLDDNFKKSFQNVLCLVKVSGTD
DGERSDSKQDKSRLNETTETQRTEFLEVLFQGPHHHHHHHHHH

Sequence of entity 2 (B), FASTA

>7XNA_2 CYN 154806 (chains B)
XFCYWKTCYX

Primary citation

Structural insights into ligand recognition and selectivity of somatostatin receptors. Zhao, W., Han, S., Qiu, N. et al. Cell Res (2022) 32:761-772. DOI 10.1038/s41422-022-00679-x · PubMed

Other PDB entries of the same protein (UniProt P09850 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8QY3 1.24 Å, Xylanase from Bacillus circulans mutant E78Q/F125A bound to xylotriose
8R85 1.3 Å, Xylanase from Bacillus circulans mutant E78Q/W9A
8QXY 1.41 Å, Xylanase from Bacillus circulans mutant E78Q bound to xylotriose
1XNB 1.49 Å, High-resolution structures of xylanases from B. Circulans and T. Harzianum identify a…
2BVV 1.5 Å, Sugar ring distortion in the glycosyl-enzyme intermediate of a family G/11 xylanase.
8QXZ 1.5 Å, Xylanase from Bacillus circulans mutant E78Q/Y69A
8R86 1.5 Å, Xylanase from Bacillus circulans mutant E78Q/W71A
1C5H 1.55 Å, Hydrogen bonding and catalysis: an unexpected explanation for how a single amino acid…
3VZK 1.55 Å, Crystal structure of the Bacillus circulans endo-beta-(1,4)-xylanase (BcX) N35E mutant
1HV0 1.6 Å, Dissecting electrostatic interactions and the PH-dependent activity of a family 11…
1XNC 1.6 Å, Thermostabilization of the bacillus circulans xylanase, by the introduction of disulfide…
3VZN 1.67 Å, Crystal structure of the Bacillus circulans endo-beta-(1,4)-xylanase (BcX) N35E mutant…

Browse structure collections

About this viewer

MolViewer shows 7XNA directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.