7XW7: TSHR-K1-70 complex

TSHR-K1-70 complex. Determined by electron microscopy at 5.5 Å resolution. Released 17 Aug 2022.

Method: Electron microscopy
Resolution: 5.5 Å
Organism: Homo sapiens
Chains: 2
Atoms: 3,923
Mol. weight: 104.29 kDa
Released: 17 Aug 2022

Explore 7XW7 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7XW7 contains 21 α-helices and 51 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 25 β-strands

Element	Residues	Length	Sheet
β-strand	3-6	4	1
α-helix	7-9	3
β-strand	10-12	3	2
β-strand	18-25	8	1
β-strand	33-39	7	2
β-strand	45-52	8	2
β-strand	57-60	4	2
β-strand	69-73	5	1
β-strand	78-83	6	1
α-helix	88-90	3
β-strand	92-99	8	2
β-strand	108-109	2	2
β-strand	113-117	5	2
β-strand	121	1	3
β-strand	122	1	4
β-strand	126-129	4	5
β-strand	135-140	6	4
β-strand	152-156	5	5
β-strand	163-166	4	5
β-strand	167	1	6
β-strand	171	1	6
β-strand	180-185	6	4
β-strand	188-193	6	4
α-helix	198-200	3
β-strand	203-209	7	5
β-strand	216-218	3	5
β-strand	219	1	3
β-strand	222-226	5	5

Chain R: 18 helices, 26 β-strands

Element	Residues	Length	Sheet
β-strand	30-33	4	7
β-strand	37-42	6	7
β-strand	56-60	5	7
β-strand	66-67	2	8
α-helix	68	1
β-strand	80-84	5	7
β-strand	91-92	2	8
β-strand	97-98	2	9
β-strand	105-111	7	7
β-strand	116-117	2	8
β-strand	122-123	2	9
β-strand	130-136	7	7
β-strand	149	1	10
β-strand	153-159	7	7
β-strand	161	1	11
β-strand	166-167	2	12
α-helix	168	1
β-strand	176	1	10
β-strand	179-183	5	7
β-strand	187	1	11
β-strand	191-192	2	12
β-strand	201-206	6	7
β-strand	215-216	2	12
β-strand	226	1	7
β-strand	230-232	3	7
β-strand	251-254	4	7
α-helix	266-269	4
β-strand	274-277	4	7
α-helix	280-286	7
β-strand	397-399	3	7
α-helix	415-441	27
α-helix	448-476	29
α-helix	481-490	10
α-helix	492-524	33
α-helix	529-531	3
α-helix	532-534	3
α-helix	535-554	20
α-helix	555-557	3
α-helix	563-565	3
α-helix	577-609	33
α-helix	617-648	32
α-helix	656-674	19
α-helix	675-680	6
α-helix	683-695	13

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
K1-70 scFv	A	protein	227	Homo sapiens
Thyrotropin receptor	R	protein	702	Homo sapiens	P16473 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>7XW7_1 K1-70 scFv (chains A)
EVQLVQSGAEVKKPGQSLKISCKASGYSLTDNWIGWVRQKPGKGLEWMGIIYPGDSDTRY
SPSFQGQVTISADKSINTAYLQWSSLKASDTAIYYCVGLDWNYNPLRYWGPGTLVTVSSV
LTQPPSVSAAPGQKVTISCSGSSSDIGSNYVSWYQQFPGTAPKLLIYDNNKRPSAIPDRF
SGSKSGTSATLGITGLQTGDEADYYCGTWDSRLGIAVFGGGTQLTVL

Sequence of entity 2 (R), FASTA

>7XW7_2 Thyrotropin receptor (chains R)
GMGCSSPPCECHQEEDFRVTCKDIQRIPSLPPSTQTLKLIETHLRTIPSHAFSNLPNISR
IYVSIDVTLQQLESHSFYNLSKVTHIEIRNTRNLTYIDPDALKELPLLKFLGIFNTGLKM
FPDLTKVYSTDIFFILEITDNPYMTSIPVNAFQGLCNETLTLKLYNNGFTSVQGYAFNGT
KLDAVYLNKNKYLTVIDKDAFGGVYSGPSLLDVSQTSVTALPSKGLEHLKELIARNTWTL
KKLPLSLSFLHLTRADLSYPSHCCAFKNQKKIRGILESLMCNESSMQSLRQRKSVNNKTL
KNPQEETLQAFDSHYDYTICGDSEDMVCTPKSDEFNPCEDIMGYKFLRIVVWFVSLLALL
GNVFVLLILLTSHYKLNVPRFLMCNLAFADFCMGMYLLLIASVDLYTHSEYYNHAIDWQT
GPGCNTAGFFTVFASELSVYTLTVITLERWYAITFAMRLDRKIRLRHACAIMVGGWVCCF
LLALLPLVGISSYAKVSICLPMDTETPLALAYIVFVLTLNIVAFVIVCCCYVKIYITVRN
PQYNPGDKDTKIAKRMAVLIFTDFICMAPISFYALSAILNKPLITVSNSKILLVLFYPLN
SCANPFLYAIFTKAFQRDVFILLSKFGICKRQAQAYRGQRVPPKNSTDIQVQKVTHDMRQ
GLHNMEDVYELIENSHLTPKKQGQISEEYMQTVLHHHHHHHH

Primary citation

Hormone- and antibody-mediated activation of the thyrotropin receptor. Duan, J., Xu, P., Luan, X. et al. Nature (2022) 609:854-859. DOI 10.1038/s41586-022-05173-3 · PubMed

Other PDB entries of the same protein (UniProt P16473 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2XWT 1.9 Å, Crystal structure of the tsh receptor in complex with a blocking type tshr autoantibody
7UTZ 2.4 Å, Human thyrotropin analog TR1402 bound to human Thyrotropin receptor in complex with…
3G04 2.55 Å, Crystal structure of the TSH receptor in complex with a thyroid-stimulating autoantibody
7XW6 2.78 Å, TSHR-Gs-M22 antibody-ML109 complex
7T9I 2.9 Å, Native human TSH bound to human Thyrotropin receptor in complex with miniGs399…
7T9N 2.9 Å, M22 Agonist Autoantibody bound to Human Thyrotropin receptor in complex with miniGs399…
7XW5 2.96 Å, TSHR-thyroid stimulating hormone-Gs-ML109 complex
7T9M 3.1 Å, Human Thyrotropin receptor bound by CS-17 Inverse Agonist Fab/Org 274179-0 Antagonist

Browse structure collections

About this viewer

MolViewer shows 7XW7 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.