7Y1P: Rgs-homologous domain of axin

Crystal structure of the rgs-homologous domain of axin in complex with lz-22Na. Determined by X-ray diffraction at 2.6 Å resolution. Released 13 Dec 2023.

Method: X-ray diffraction
Resolution: 2.6 Å
Organism: Homo sapiens
Chains: 4
Atoms: 4,383
Mol. weight: 67.45 kDa
Ligands: I5L
Released: 13 Dec 2023

Explore 7Y1P in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7Y1P contains 54 α-helices and 0 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 14 helices, 0 β-strands

Element	Residues	Length
α-helix	78-80	3
α-helix	81-87	7
α-helix	89-92	4
α-helix	96-109	14
α-helix	112-125	14
α-helix	131-133	3
α-helix	134-144	11
α-helix	145-150	6
α-helix	155-159	5
α-helix	162-174	13
α-helix	183-192	10
α-helix	193-197	5
α-helix	198-202	5
α-helix	205-213	9

Chain B: 15 helices, 0 β-strands

Element	Residues	Length
α-helix	78-80	3
α-helix	81-87	7
α-helix	89-93	5
α-helix	96-109	14
α-helix	112-125	14
α-helix	128-129	2
α-helix	131-133	3
α-helix	134-144	11
α-helix	145-150	6
α-helix	155-159	5
α-helix	162-173	12
α-helix	183-192	10
α-helix	193-197	5
α-helix	198-202	5
α-helix	205-212	8

Chain C: 13 helices, 0 β-strands

Element	Residues	Length
α-helix	78-80	3
α-helix	81-87	7
α-helix	89-93	5
α-helix	96-109	14
α-helix	112-126	15
α-helix	135-144	10
α-helix	145-149	5
α-helix	155-159	5
α-helix	162-173	12
α-helix	183-192	10
α-helix	193-197	5
α-helix	198-202	5
α-helix	205-212	8

Chain D: 12 helices, 0 β-strands

Element	Residues	Length
α-helix	78-80	3
α-helix	81-87	7
α-helix	89-92	4
α-helix	96-109	14
α-helix	112-126	15
α-helix	134-144	11
α-helix	145-149	5
α-helix	155-159	5
α-helix	162-173	12
α-helix	183-195	13
α-helix	197-202	6
α-helix	205-212	8

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Axin-1	A, B, C, D	protein	147	Homo sapiens	O15169 (AlphaFold model)

Sequence of entity 1 (A, B, C, D), FASTA

>7Y1P_1 Axin-1 (chains A, B, C, D)
GSASPTPPYLKWAESLHSLLDDQDGISLFRTFLKQEGCADLLDFWFACTGFRKLEPCDSN
EEKRLKLARAIYRKYILDNNGIVSRQTKPATKSFIKGCIMKQLIDPAMFDQAQTEIQATM
EENTYPSFLKSDIYLEYTRTGSESPKV

Ligands and cofactors

ID	Name	Formula	Copies
I5L	(2~{Z},4~{Z})-2-methyl-5-(8-oxidanyldibenzofuran-4-yl)penta-2,4-dienal	C18 H14 O3	1

Primary citation

CRYSTAL STRUCTURE OF THE RGS-HOMOLOGOUS DOMAIN OF AXIN IN COMPLEX WITH LZ-22Na. He, Z., Yuchi, Z. To be published.

Other PDB entries of the same protein (UniProt O15169 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1DK8 1.57 Å, Crystal structure of the rgs-homologous domain of axin
7SXJ 1.85 Å, BIO-2895 (BRD0705) bound GSK3beta-axin complex
1EMU 1.9 Å, Structure of the axin rgs-homologous domain in complex with a samp repeat from apc
7SXF 1.94 Å, BIO-2895 (BRD0705) bound GSK3alpha-axin complex
8RU3 2.0 Å, Crystal structure of beta-catenin in complex with alpha-helical peptide inhibitor
7SXH 2.09 Å, BIO-8546 bound GSK3beta-axin complex
4NM3 2.1 Å, Crystal structure of GSK-3/Axin complex bound to phosphorylated N-terminal…
5WZZ 2.1 Å, The SIAH E3 ubiquitin ligases promote Wnt/ beta-catenin signaling through mediating…
8RU4 2.13 Å, Crystal structure of Human Catenin Beta-1 in complex with stitched peptide inhibitor
4NM5 2.3 Å, Crystal structure of GSK-3/Axin complex bound to phosphorylated Wnt receptor LRP6 c-motif
4NM7 2.3 Å, Crystal structure of GSK-3/Axin complex bound to phosphorylated Wnt receptor LRP6 e-motif
8VME 2.3 Å, Crystal structure of the GSK-3/Axin complex bound to a phosphorylated beta-catenin T41A…

Browse structure collections

About this viewer

MolViewer shows 7Y1P directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.