7YO8: Fission yeast Hfl1 LIR fused to human GABARAPL2

Crystal structure of fission yeast Hfl1 LIR fused to human GABARAPL2. Determined by X-ray diffraction at 1.8 Å resolution. Released 2 Nov 2022.

Method: X-ray diffraction
Resolution: 1.8 Å
Organisms: Schizosaccharomyces pombe, Homo sapiens
Chains: 1
Atoms: 1,287
Mol. weight: 17.25 kDa
Released: 2 Nov 2022

Explore 7YO8 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7YO8 contains 8 α-helices and 8 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 8 β-strands

Element	Residues	Length	Sheet
α-helix	11-17	7
α-helix	30-33	4
α-helix	36-49	14
β-strand	53-60	8	1
α-helix	61	1
α-helix	67-69	3
β-strand	73-77	5	1
β-strand	81	1	2
α-helix	82-93	12
β-strand	102-104	3	1
β-strand	105	1	3
β-strand	108	1	3
β-strand	115	1	2
α-helix	116-123	8
α-helix	129	1
β-strand	130-135	6	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Transmembrane protein 184 homolog C30D11.06c,Gamma-aminobutyric acid receptor-associated…	A	protein	147	Schizosaccharomyces pombe, Homo sapiens	P60520 (AlphaFold model), Q09906 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>7YO8_1 Transmembrane protein 184 homolog C30D11.06c,Gamma-aminobutyric acid receptor-associated protein-like 2 (chains A)
MLQFEIDDEMEPLYNQAKQMRYGDYMKSTFKEDHSLEHRCVESAKIRAKYPDRVPVIVEK
VSGSQIVDIDKRKYLVPSDITVAQFMWIIRKRIQLPSEKAIFLFVDKTVPQSSLTMGQLY
EKEKDEDGFLYVAYSGENTFGLEVLFQ

Primary citation

Development of new tools to study membrane-anchored mammalian Atg8 proteins. Park, S.W., Jeon, P., Yamasaki, A. et al. Autophagy (2023) 19:1424-1443. DOI 10.1080/15548627.2022.2132040 · PubMed

Other PDB entries of the same protein (UniProt P60520 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8Q6Q 1.8 Å, Structure of human immunity related GTPase Q in complex with GABARAPL2.
7LK3 1.9 Å, Crystal structure of untwinned human GABARAPL2
4CO7 2.0 Å, Crystal structure of human GATE-16
6H8C Structure of the human GABARAPL2 protein in complex with the UBA5 LIR motif

Browse structure collections

About this viewer

MolViewer shows 7YO8 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.