FAB in complex with antigenic peptide of interleukin-2. Determined by X-ray diffraction at 2.6 Å resolution. Released 1 Feb 2023.
Explore 7YZJ in 3D Show helices and sheets RCSB PDB PDBe
7YZJ contains 13 α-helices and 46 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 66-71 | 6 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 3-7 | 5 | 7 |
| β-strand | 11-12 | 2 | 8 |
| β-strand | 18-25 | 8 | 7 |
| β-strand | 34-39 | 7 | 9 |
| β-strand | 45-52 | 8 | 9 |
| β-strand | 57-59 | 3 | 9 |
| α-helix | 64-66 | 3 | |
| β-strand | 67-72 | 6 | 7 |
| β-strand | 77-82 | 6 | 7 |
| α-helix | 84-86 | 3 | |
| β-strand | 88-95 | 8 | 9 |
| β-strand | 102-103 | 2 | 9 |
| β-strand | 107-109 | 3 | 9 |
| β-strand | 110-111 | 2 | 8 |
| α-helix | 115-116 | 2 | |
| β-strand | 117 | 1 | 10 |
| α-helix | 118-119 | 2 | |
| β-strand | 120-124 | 5 | 11 |
| β-strand | 137-147 | 11 | 11 |
| β-strand | 148 | 1 | 10 |
| β-strand | 153-157 | 4 | 12 |
| β-strand | 166 | 1 | 12 |
| β-strand | 171-179 | 9 | 11 |
| β-strand | 184-194 | 11 | 11 |
| β-strand | 207-212 | 6 | 12 |
| α-helix | 213-215 | 3 | |
| β-strand | 217-222 | 6 | 12 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 4-7 | 4 | 1 |
| β-strand | 10-14 | 5 | 2 |
| β-strand | 19-25 | 7 | 1 |
| β-strand | 27C | 1 | 3 |
| β-strand | 31 | 1 | 3 |
| β-strand | 33-38 | 6 | 2 |
| β-strand | 45-49 | 5 | 2 |
| β-strand | 53-54 | 2 | 2 |
| α-helix | 55 | 1 | |
| β-strand | 62-67 | 6 | 1 |
| β-strand | 70-75 | 6 | 1 |
| α-helix | 80-82 | 3 | |
| β-strand | 84-90 | 7 | 2 |
| β-strand | 97-98 | 2 | 2 |
| β-strand | 99 | 1 | 1 |
| β-strand | 102-107 | 6 | 2 |
| β-strand | 111 | 1 | 4 |
| α-helix | 112-113 | 2 | |
| β-strand | 114-118 | 5 | 5 |
| α-helix | 119-121 | 3 | |
| α-helix | 122-125 | 4 | |
| β-strand | 129-139 | 11 | 5 |
| β-strand | 140 | 1 | 4 |
| β-strand | 145-150 | 6 | 6 |
| β-strand | 153-155 | 3 | 6 |
| β-strand | 159-163 | 5 | 5 |
| β-strand | 173-182 | 10 | 5 |
| α-helix | 183-187 | 5 | |
| β-strand | 191-197 | 7 | 6 |
| α-helix | 204 | 1 | |
| β-strand | 205-210 | 6 | 6 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Light chain of FAB fragment | L | protein | 219 | Mus musculus | |
| Heavy chain of FAB fragment | H | protein | 220 | Mus musculus | |
| Antigenic peptide | E | protein | 9 | Homo sapiens | P60568 (AlphaFold model) |
>7YZJ_1 Light chain of FAB fragment (chains L) DVQMTQTPLTLSVTIGQPASISCESSQSLLYSNGKTYLNWLLQRPGQSPKRLIYLVSKLD SGVPDRFTGSGSGTDFTLRISRVEAEDLGVYYCVQGTHFPRTFGGGTKLEIKRADAAPTV SIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSM SSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
>7YZJ_2 Heavy chain of FAB fragment (chains H) GVQLQESGPGLVKPSQSLSLTCTVTGYSITSDYAWNWIRQFPGNKLEWMGYITYSGSTGY NPSLKSRISITRDTSKNQFFLQLNSVTTEDTATYYCASYDDYTWFTYWGQGTLVTVSAAK TTPPSVFPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLY TLSSSVTVPSSPRPSETVTCNVAHPASSTKVDKKIVPRDC
>7YZJ_3 Antigenic peptide (chains E) KPLEEVLNL
Three-Dimensional Structure of Fab Fragment of Monoclonal Antibody LNKB-2 Complexed with Antigenic Nonapeptide from Human Interleukin-2. Pletnev, V., Pletneva, N., Goryacheva, E. et al. Russ J Bioorg Chem (2023).
Other PDB entries of the same protein (UniProt P60568 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 7YZJ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.