7Z8F: ARP1 actin related protein 1 homolog A

Composite structure of dynein-dynactin-BICDR on microtubules. Determined by electron microscopy at 20.0 Å resolution. Released 27 Jul 2022.

Method: Electron microscopy
Resolution: 20.0 Å
Organisms: Sus scrofa, Mus musculus, Homo sapiens
Chains: 43
Atoms: 118,408
Mol. weight: 4045.16 kDa
Ligands: ADP, MG, ATP, ZN
Released: 27 Jul 2022

Explore 7Z8F in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7Z8F contains 1,433 α-helices and 876 β-strands across 43 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 24 helices, 22 β-strands

Element	Residues	Length	Sheet
α-helix	10-11	2
β-strand	12-16	5	1
β-strand	20-25	6	1
β-strand	35-36	2	1
β-strand	39-42	4	2
β-strand	45-46	2	3
β-strand	57	1	2
α-helix	60-64	5
α-helix	66-68	3
β-strand	69-72	4	2
β-strand	75-76	2	4
β-strand	79-80	2	4
α-helix	83-93	11
β-strand	108-111	4	1
α-helix	118-126	9
α-helix	127-131	5
β-strand	136-140	5	1
α-helix	143-149	7
β-strand	154-160	7	5
β-strand	165-171	7	5
β-strand	174-175	2	5
α-helix	177-179	3
β-strand	181-183	3	5
α-helix	187-199	13
α-helix	208-220	13
β-strand	223	1	6
α-helix	228-233	6
α-helix	235-237	3
β-strand	240-242	3	7
β-strand	248-250	3	7
α-helix	254-257	4
α-helix	259-262	4
α-helix	265-268	4
α-helix	275-284	10
α-helix	288-296	9
β-strand	298-301	4	5
α-helix	303-306	4
β-strand	308	1	6
α-helix	310-321	12
α-helix	323	1
β-strand	330-331	2	5
α-helix	339-349	11
α-helix	351-355	5
β-strand	358-359	2	1
α-helix	360-365	6
α-helix	368-374	7

Chain B: 22 helices, 24 β-strands

Element	Residues	Length	Sheet
β-strand	12-16	5	35
β-strand	20-25	6	35
β-strand	33-36	4	35
β-strand	39-42	4	36
β-strand	45-46	2	37
β-strand	57	1	36
α-helix	60-64	5
α-helix	66-68	3
β-strand	69-72	4	36
β-strand	75-76	2	38
β-strand	79-80	2	38
α-helix	83-93	11
β-strand	108-110	3	35
β-strand	111-112	2	39
α-helix	118-126	9
α-helix	127-131	5
β-strand	136-137	2	35
β-strand	140-141	2	39
α-helix	142-150	9
β-strand	155-160	6	40
β-strand	165-171	7	40
β-strand	174-175	2	40
α-helix	176	1
β-strand	181-183	3	40
α-helix	187-200	14
α-helix	208-220	13
β-strand	223	1	41
α-helix	228-233	6
α-helix	235-236	2
β-strand	240-242	3	42
β-strand	248-250	3	42
α-helix	254-257	4
α-helix	259-262	4
α-helix	265-268	4
α-helix	275-284	10
α-helix	291-295	5
β-strand	298-301	4	40
α-helix	303-306	4
β-strand	308	1	41
α-helix	310-321	12
β-strand	328-331	4	40
α-helix	339-349	11
α-helix	351-355	5
β-strand	358-359	2	35
α-helix	360-365	6
α-helix	368-375	8

Chain C: 24 helices, 22 β-strands

Element	Residues	Length	Sheet
α-helix	6-8	3
α-helix	10-11	2
β-strand	12-16	5	52
β-strand	20-25	6	52
β-strand	33-36	4	52
β-strand	39-42	4	53
β-strand	45-46	2	54
β-strand	57	1	53
α-helix	60-64	5
α-helix	66-68	3
β-strand	69-72	4	53
β-strand	75-76	2	55
β-strand	79-80	2	55
α-helix	83-93	11
β-strand	108-112	5	52
α-helix	118-126	9
α-helix	127-131	5
β-strand	136-141	6	52
α-helix	142-150	9
β-strand	155-160	6	3
β-strand	165-171	7	3
β-strand	174-175	2	3
α-helix	177-179	3
β-strand	181-183	3	3
α-helix	187-200	14
α-helix	211-220	10
β-strand	223	1	56
α-helix	228-233	6
β-strand	240-242	3	57
β-strand	248-250	3	57
α-helix	254-257	4
α-helix	259-262	4
α-helix	265-268	4
α-helix	275-284	10
α-helix	288-296	9
β-strand	298-301	4	3
α-helix	303-306	4
β-strand	308	1	56
α-helix	310-321	12
α-helix	323	1
β-strand	330-333	4	3
α-helix	339-349	11
α-helix	351-355	5
β-strand	358-359	2	52
α-helix	360-366	7
α-helix	368-372	5

Chain D: 24 helices, 22 β-strands

Element	Residues	Length	Sheet
α-helix	10-11	2
β-strand	12-16	5	67
β-strand	20-25	6	67
β-strand	33-36	4	67
β-strand	39-42	4	68
β-strand	45-46	2	69
β-strand	57	1	68
α-helix	60-64	5
α-helix	66-68	3
β-strand	69-72	4	68
β-strand	75-76	2	70
β-strand	79-80	2	70
α-helix	83-93	11
α-helix	103-105	3
β-strand	108-112	5	67
α-helix	118-126	9
α-helix	127-131	5
β-strand	136-141	6	67
α-helix	142-150	9
β-strand	155-160	6	37
β-strand	165-171	7	37
β-strand	174-175	2	37
β-strand	181-183	3	37
α-helix	187-201	15
α-helix	208-220	13
β-strand	223	1	71
α-helix	228-234	7
α-helix	236-238	3
β-strand	240-242	3	72
β-strand	248-250	3	72
α-helix	254-257	4
α-helix	259-262	4
α-helix	265-268	4
α-helix	275-284	10
α-helix	290-296	7
β-strand	298-301	4	37
α-helix	303-306	4
β-strand	308	1	71
α-helix	310-321	12
α-helix	323	1
β-strand	329-331	3	37
α-helix	339-348	10
α-helix	351-355	5
β-strand	358-359	2	67
α-helix	360-366	7
α-helix	368-375	8

Chain e: 232 helices, 89 β-strands

Element	Residues	Length	Sheet
α-helix	27-42	16
α-helix	48-49	2
α-helix	50-57	8
α-helix	59-70	12
β-strand	76-86	11	9
α-helix	87-88	2
α-helix	94-95	2
β-strand	96-104	9	9
β-strand	113-120	8	9
α-helix	131-134	4
β-strand	135-140	6	9
α-helix	145-152	8
α-helix	153-157	5
α-helix	158-168	11
α-helix	170-172	3
α-helix	178-198	21
α-helix	203-205	3
α-helix	208-210	3
α-helix	211-222	12
α-helix	230-237	8
α-helix	239-260	22
α-helix	271-292	22
α-helix	295-306	12
α-helix	310-318	9
α-helix	322-332	11
α-helix	341-346	6
α-helix	350-364	15
α-helix	367-369	3
α-helix	374-399	26
α-helix	406-440	35
α-helix	456-483	28
α-helix	514-531	18
α-helix	540-574	35
α-helix	578-587	10
α-helix	590-592	3
α-helix	597-624	28
α-helix	631-638	8
α-helix	643-669	27
α-helix	673-675	3
α-helix	677-692	16
α-helix	696-709	14
β-strand	718	1	219
β-strand	721-723	3	220
α-helix	731	1
β-strand	732-734	3	220
β-strand	737	1	219
α-helix	742-756	15
α-helix	762-797	36
α-helix	799-802	4
α-helix	806-821	16
α-helix	829-866	38
α-helix	871-890	20
α-helix	896-927	32
α-helix	930-932	3
α-helix	933-935	3
α-helix	955-957	3
β-strand	958	1	221
β-strand	961	1	221
β-strand	962-965	4	222
β-strand	968-971	4	222
α-helix	975-994	20
β-strand	997	1	223
α-helix	998-999	2
α-helix	1014-1017	4
β-strand	1018	1	223
α-helix	1022-1025	4
α-helix	1031-1055	25
α-helix	1056-1058	3
α-helix	1059-1062	4
α-helix	1065-1072	8
α-helix	1076-1091	16
β-strand	1099-1102	4	221
β-strand	1105-1108	4	221
α-helix	1110-1155	46
α-helix	1163-1199	37
α-helix	1211-1264	54
α-helix	1273-1303	31
α-helix	1311-1313	3
α-helix	1314-1348	35
β-strand	1350	1	224
α-helix	1351-1353	3
α-helix	1356-1370	15
α-helix	1375-1379	5
α-helix	1381-1395	15
α-helix	1397-1403	7
α-helix	1410-1420	11
β-strand	1430	1	224
α-helix	1431-1436	6
α-helix	1443-1472	30
β-strand	1474	1	225
β-strand	1477-1480	4	226
β-strand	1484-1487	4	226
α-helix	1490-1507	18
α-helix	1517-1551	35
α-helix	1557-1560	4
α-helix	1562-1583	22
β-strand	1587	1	225
α-helix	1588-1592	5
α-helix	1597-1625	29
α-helix	1627-1631	5
α-helix	1634-1642	9
α-helix	1647-1653	7
α-helix	1654-1657	4
β-strand	1663-1666	4	227
β-strand	1672-1677	6	227
β-strand	1683-1691	9	227
α-helix	1698-1728	31
α-helix	1735-1744	10
α-helix	1747-1769	23
α-helix	1776-1797	22
α-helix	1802-1828	27
α-helix	1836-1839	4
β-strand	1843-1846	4	228
β-strand	1857-1861	5	228
β-strand	1864-1867	4	228
α-helix	1883-1897	15
β-strand	1901-1905	5	229
α-helix	1912-1922	11
α-helix	1925-1926	2
β-strand	1927-1931	5	229
α-helix	1941-1951	11
β-strand	1954-1958	5	229
α-helix	1960-1962	3
α-helix	1965-1983	19
α-helix	1984-1986	3
β-strand	1998-2001	4	230
β-strand	2004-2007	4	230
β-strand	2013-2016	4	229
β-strand	2018	1	229
α-helix	2027-2029	3
β-strand	2036-2040	5	229
α-helix	2046-2056	11
α-helix	2063-2079	17
α-helix	2081-2082	2
α-helix	2090-2117	28
α-helix	2124-2129	6
α-helix	2133-2145	13
α-helix	2146-2148	3
α-helix	2154-2164	11
α-helix	2171-2174	4
α-helix	2176-2188	13
α-helix	2201-2216	16
β-strand	2219-2222	4	231
α-helix	2224-2225	2
α-helix	2230-2245	16
β-strand	2249-2254	6	231
α-helix	2261-2265	5
β-strand	2268	1	232
β-strand	2275	1	232
α-helix	2279-2289	11
β-strand	2298-2304	7	231
α-helix	2310-2312	3
α-helix	2313-2319	7
β-strand	2324-2326	3	233
β-strand	2332-2334	3	233
α-helix	2335-2336	2
β-strand	2339-2344	6	231
α-helix	2353-2358	6
β-strand	2360-2362	3	231
α-helix	2366-2368	3
α-helix	2371-2384	14
α-helix	2396-2399	4
α-helix	2411-2423	13
α-helix	2424-2427	4
α-helix	2432-2442	11
α-helix	2451-2475	25
α-helix	2483-2502	20
α-helix	2503-2505	3
α-helix	2508-2521	14
α-helix	2534-2536	3
β-strand	2537-2539	3	234
α-helix	2540	1
β-strand	2545-2547	3	234
α-helix	2548-2551	4
α-helix	2568-2570	3
α-helix	2572-2586	15
β-strand	2591-2594	4	235
α-helix	2601-2611	11
β-strand	2616-2620	5	235
α-helix	2628-2638	11
β-strand	2639-2643	5	236
β-strand	2648-2652	5	236
β-strand	2659-2663	5	235
α-helix	2670-2671	2
α-helix	2678-2689	12
β-strand	2691-2694	4	236
β-strand	2699-2703	5	236
β-strand	2706-2711	6	235
α-helix	2722-2724	3
α-helix	2725-2728	4
β-strand	2733-2735	3	235
α-helix	2740-2755	16
α-helix	2763-2765	3
α-helix	2766-2783	18
α-helix	2796-2810	15
α-helix	2818-2829	12
α-helix	2830-2834	5
α-helix	2840-2857	18
α-helix	2863-2866	4
β-strand	2873-2874	2	237
β-strand	2882-2883	2	237
α-helix	2886-2901	16
α-helix	2913-2927	15
β-strand	2933-2936	4	238
α-helix	2946-2953	8
α-helix	2956	1
β-strand	2957-2960	4	238
α-helix	2969-2980	12
α-helix	2981-2985	5
β-strand	2990-2995	6	238
α-helix	3007-3014	8
α-helix	3024-3040	17
α-helix	3047-3061	15
β-strand	3062-3068	7	238
α-helix	3081-3082	2
α-helix	3083-3088	6
β-strand	3090-3093	4	238
α-helix	3099-3107	9
α-helix	3139-3163	25
α-helix	3173-3297	125
α-helix	3301-3308	8
α-helix	3315-3328	14
α-helix	3335-3343	9
α-helix	3347-3352	6
α-helix	3361-3371	11
α-helix	3379-3385	7
α-helix	3390-3515	126
α-helix	3522-3538	17
α-helix	3549-3552	4
α-helix	3556-3564	9
α-helix	3571-3579	9
α-helix	3586	1
β-strand	3587-3590	4	239
α-helix	3595-3603	9
α-helix	3605-3607	3
β-strand	3610-3613	4	239
α-helix	3617-3619	3
α-helix	3620-3629	10
β-strand	3633-3636	4	239
α-helix	3638-3640	3
α-helix	3643-3645	3
α-helix	3646-3650	5
β-strand	3654-3656	3	240
β-strand	3659-3664	6	240
β-strand	3667-3670	4	240
β-strand	3677-3681	5	239
α-helix	3690-3694	5
β-strand	3697-3700	4	239
α-helix	3705-3720	16
α-helix	3722-3729	8
α-helix	3736-3751	16
α-helix	3767-3785	19
α-helix	3789-3800	12
α-helix	3802-3817	16
α-helix	3818-3820	3
α-helix	3829-3840	12
α-helix	3844-3846	3
α-helix	3852-3872	21
α-helix	3880-3894	15
α-helix	3902-3910	9
α-helix	3929-3938	10
α-helix	3947-3953	7
α-helix	3957-3961	5
α-helix	3966-3969	4
α-helix	3979-3981	3
α-helix	3982-3996	15
α-helix	3998-4000	3
α-helix	4001-4012	12
α-helix	4027-4029	3
α-helix	4030-4034	5
β-strand	4041-4045	5	241
α-helix	4052-4062	11
β-strand	4066-4070	5	241
α-helix	4074-4090	17
β-strand	4093-4097	5	241
α-helix	4099-4101	3
α-helix	4103-4113	11
β-strand	4123-4129	7	241
α-helix	4136-4140	5
β-strand	4143-4147	5	241
α-helix	4149-4151	3
α-helix	4153-4163	11
α-helix	4166-4170	5
α-helix	4175-4193	19
α-helix	4194-4196	3
α-helix	4209-4227	19
α-helix	4240-4246	7
α-helix	4247-4251	5
α-helix	4259-4272	14
α-helix	4275-4278	4
β-strand	4283-4288	6	242
β-strand	4292-4295	4	242
α-helix	4296-4297	2
α-helix	4302-4310	9
α-helix	4318-4321	4
α-helix	4326-4344	19
α-helix	4376-4390	15
α-helix	4396-4398	3
α-helix	4402-4405	4
α-helix	4408-4439	32
α-helix	4446-4457	12
α-helix	4459-4461	3
α-helix	4462-4464	3
α-helix	4475-4499	25
α-helix	4500-4502	3
α-helix	4503-4506	4
β-strand	4509-4510	2	243
α-helix	4511-4513	3
α-helix	4517-4532	16
β-strand	4539-4545	7	243
α-helix	4552-4554	3
β-strand	4557-4561	5	243
β-strand	4564-4566	3	244
β-strand	4568-4571	4	244
β-strand	4574-4577	4	244
β-strand	4583-4584	2	244
β-strand	4588-4594	7	243
β-strand	4604-4610	7	244
β-strand	4618-4626	9	244
α-helix	4632-4638	7
β-strand	4641-4643	3	244

Chain E: 25 helices, 22 β-strands

Element	Residues	Length	Sheet
α-helix	10-11	2
β-strand	12-16	5	75
β-strand	20-25	6	75
β-strand	33-36	4	75
β-strand	39-42	4	76
β-strand	45-46	2	77
β-strand	57	1	76
α-helix	60-64	5
α-helix	66-68	3
β-strand	69-72	4	76
β-strand	75-76	2	78
β-strand	79-80	2	78
α-helix	83-93	11
β-strand	108-111	4	75
α-helix	118-126	9
α-helix	127-131	5
β-strand	136-140	5	75
α-helix	143-150	8
β-strand	155-160	6	54
β-strand	165-171	7	54
β-strand	174-175	2	54
α-helix	177-179	3
β-strand	181-183	3	54
α-helix	187-200	14
α-helix	208-220	13
β-strand	223	1	79
α-helix	228-233	6
α-helix	235-238	4
β-strand	240-242	3	80
β-strand	248-250	3	80
α-helix	254-257	4
α-helix	259-262	4
α-helix	265-268	4
α-helix	275-285	11
α-helix	288-290	3
α-helix	291-295	5
β-strand	298-301	4	54
α-helix	303-306	4
β-strand	308	1	79
α-helix	310-321	12
α-helix	323	1
β-strand	329-331	3	54
α-helix	339-349	11
α-helix	351-355	5
β-strand	358-359	2	75
α-helix	360-366	7
α-helix	369-373	5

Chain f: 240 helices, 89 β-strands

Element	Residues	Length	Sheet
α-helix	22-23	2
β-strand	24	1	8
α-helix	25-26	2
α-helix	27-42	16
α-helix	48-49	2
α-helix	50-57	8
α-helix	59-70	12
β-strand	76-86	11	9
α-helix	87-88	2
α-helix	94-95	2
β-strand	96-104	9	9
β-strand	113-120	8	9
β-strand	126	1	8
α-helix	131-134	4
β-strand	135-140	6	9
α-helix	145-152	8
α-helix	153-157	5
α-helix	158-168	11
α-helix	170-172	3
α-helix	178-197	20
α-helix	211-222	12
α-helix	229-232	4
α-helix	233-236	4
α-helix	239-260	22
α-helix	271-292	22
α-helix	295-306	12
α-helix	310-314	5
α-helix	315-319	5
α-helix	322-336	15
α-helix	341-345	5
α-helix	350-364	15
α-helix	365-368	4
α-helix	374-399	26
α-helix	401-403	3
α-helix	406-440	35
α-helix	455-484	30
α-helix	514-531	18
α-helix	540-574	35
α-helix	578-587	10
α-helix	590-593	4
α-helix	597-624	28
α-helix	631-638	8
α-helix	643-669	27
α-helix	673-675	3
α-helix	677-692	16
α-helix	696-709	14
β-strand	716	1	10
β-strand	718-724	7	11
β-strand	731-737	7	11
α-helix	741-753	13
α-helix	754-756	3
α-helix	762-797	36
α-helix	802-805	4
α-helix	806-820	15
β-strand	823	1	10
α-helix	829-865	37
α-helix	871-890	20
α-helix	896-927	32
α-helix	930-932	3
β-strand	958-965	8	12
β-strand	968-972	5	12
α-helix	975-994	20
β-strand	997	1	13
α-helix	998-999	2
α-helix	1011-1013	3
α-helix	1014-1017	4
β-strand	1018	1	13
α-helix	1020-1025	6
α-helix	1031-1055	25
α-helix	1056-1058	3
α-helix	1059-1062	4
α-helix	1065-1072	8
α-helix	1076-1091	16
β-strand	1099-1102	4	12
β-strand	1105-1108	4	12
α-helix	1110-1155	46
α-helix	1163-1199	37
α-helix	1211-1264	54
α-helix	1273-1303	31
α-helix	1311-1313	3
α-helix	1314-1347	34
β-strand	1350	1	14
α-helix	1351-1353	3
α-helix	1356-1370	15
α-helix	1375-1378	4
α-helix	1381-1395	15
α-helix	1397-1403	7
α-helix	1410-1420	11
β-strand	1430	1	14
α-helix	1431-1436	6
α-helix	1443-1472	30
β-strand	1474	1	15
β-strand	1477-1480	4	16
β-strand	1484-1487	4	16
α-helix	1490-1507	18
α-helix	1513-1515	3
α-helix	1517-1551	35
α-helix	1557-1560	4
α-helix	1562-1583	22
β-strand	1587	1	15
α-helix	1588-1592	5
α-helix	1597-1625	29
α-helix	1627-1631	5
α-helix	1634-1642	9
α-helix	1647-1653	7
α-helix	1654-1657	4
β-strand	1663-1666	4	17
β-strand	1672-1677	6	17
β-strand	1683-1691	9	17
α-helix	1698-1728	31
α-helix	1735-1744	10
α-helix	1747-1769	23
α-helix	1776-1797	22
α-helix	1802-1828	27
α-helix	1836-1839	4
β-strand	1843-1846	4	18
β-strand	1857-1861	5	18
β-strand	1864-1867	4	18
α-helix	1876-1878	3
α-helix	1883-1897	15
β-strand	1901-1905	5	19
α-helix	1912-1922	11
α-helix	1925-1926	2
β-strand	1927-1931	5	19
α-helix	1938-1940	3
α-helix	1941-1951	11
β-strand	1954-1958	5	19
α-helix	1960-1962	3
α-helix	1965-1983	19
β-strand	1998-2001	4	20
β-strand	2004-2007	4	20
β-strand	2013-2016	4	19
β-strand	2018	1	19
α-helix	2027-2029	3
β-strand	2036-2040	5	19
α-helix	2046-2056	11
α-helix	2063-2079	17
α-helix	2081-2082	2
α-helix	2090-2117	28
α-helix	2124-2129	6
α-helix	2133-2145	13
α-helix	2146-2148	3
α-helix	2154-2164	11
α-helix	2171-2174	4
α-helix	2176-2188	13
α-helix	2201-2216	16
β-strand	2219-2222	4	21
α-helix	2224-2225	2
α-helix	2230-2245	16
β-strand	2249-2254	6	21
α-helix	2261-2265	5
β-strand	2268	1	22
β-strand	2275	1	22
α-helix	2279-2289	11
β-strand	2298-2304	7	21
α-helix	2310-2312	3
α-helix	2313-2319	7
β-strand	2324-2326	3	23
β-strand	2332-2334	3	23
α-helix	2335-2336	2
β-strand	2339-2344	6	21
α-helix	2353-2358	6
β-strand	2360-2362	3	21
α-helix	2366-2368	3
α-helix	2371-2384	14
α-helix	2396-2399	4
α-helix	2411-2423	13
α-helix	2424-2427	4
α-helix	2432-2442	11
α-helix	2451-2475	25
α-helix	2483-2502	20
α-helix	2503-2505	3
α-helix	2508-2521	14
α-helix	2534-2536	3
β-strand	2537-2539	3	24
α-helix	2540	1
β-strand	2545-2547	3	24
α-helix	2548-2551	4
α-helix	2568-2570	3
α-helix	2572-2586	15
β-strand	2591-2594	4	25
α-helix	2601-2611	11
β-strand	2616-2620	5	25
α-helix	2628-2638	11
β-strand	2639-2643	5	26
β-strand	2648-2652	5	26
β-strand	2659-2663	5	25
α-helix	2670-2671	2
α-helix	2678-2689	12
β-strand	2691-2694	4	26
β-strand	2699-2703	5	26
β-strand	2706-2711	6	25
α-helix	2722-2724	3
α-helix	2725-2728	4
β-strand	2733-2735	3	25
α-helix	2740-2755	16
α-helix	2756-2758	3
α-helix	2763-2765	3
α-helix	2766-2783	18
α-helix	2796-2810	15
α-helix	2818-2829	12
α-helix	2830-2834	5
α-helix	2840-2857	18
α-helix	2863-2866	4
β-strand	2873-2874	2	27
β-strand	2882-2883	2	27
α-helix	2886-2901	16
α-helix	2913-2927	15
β-strand	2933-2936	4	28
α-helix	2946-2953	8
α-helix	2956	1
β-strand	2957-2960	4	28
α-helix	2969-2980	12
α-helix	2981-2985	5
β-strand	2990-2995	6	28
α-helix	3004-3006	3
α-helix	3007-3014	8
α-helix	3024-3040	17
α-helix	3047-3061	15
β-strand	3062-3068	7	28
α-helix	3081-3082	2
α-helix	3083-3088	6
β-strand	3090-3093	4	28
α-helix	3099-3107	9
α-helix	3139-3163	25
α-helix	3166-3168	3
α-helix	3173-3297	125
α-helix	3301-3308	8
α-helix	3315-3328	14
α-helix	3335-3343	9
α-helix	3347-3352	6
α-helix	3361-3371	11
α-helix	3379-3385	7
α-helix	3390-3515	126
α-helix	3522-3538	17
α-helix	3549-3552	4
α-helix	3556-3564	9
α-helix	3571-3579	9
α-helix	3586	1
β-strand	3587-3590	4	29
α-helix	3595-3603	9
α-helix	3605-3607	3
β-strand	3610-3613	4	29
α-helix	3617-3619	3
α-helix	3620-3629	10
β-strand	3633-3636	4	29
α-helix	3638-3640	3
α-helix	3643-3645	3
α-helix	3646-3650	5
β-strand	3654-3656	3	30
β-strand	3659-3664	6	30
β-strand	3667-3670	4	30
β-strand	3677-3681	5	29
α-helix	3690-3694	5
β-strand	3697-3700	4	29
α-helix	3705-3720	16
α-helix	3722-3729	8
α-helix	3736-3751	16
α-helix	3767-3785	19
α-helix	3789-3800	12
α-helix	3802-3817	16
α-helix	3818-3820	3
α-helix	3829-3840	12
α-helix	3844-3846	3
α-helix	3852-3872	21
α-helix	3877-3879	3
α-helix	3880-3894	15
α-helix	3902-3910	9
α-helix	3921-3923	3
α-helix	3929-3938	10
α-helix	3947-3953	7
α-helix	3957-3961	5
α-helix	3966-3969	4
α-helix	3979-3981	3
α-helix	3982-3996	15
α-helix	3998-4000	3
α-helix	4001-4012	12
α-helix	4027-4033	7
β-strand	4041-4045	5	31
α-helix	4052-4062	11
β-strand	4066-4070	5	31
α-helix	4074-4090	17
β-strand	4093-4097	5	31
α-helix	4099-4101	3
α-helix	4103-4113	11
β-strand	4123-4129	7	31
α-helix	4136-4140	5
β-strand	4143-4147	5	31
α-helix	4149-4151	3
α-helix	4153-4163	11
α-helix	4166-4170	5
α-helix	4176-4193	18
α-helix	4194-4196	3
α-helix	4209-4227	19
α-helix	4240-4246	7
α-helix	4247-4251	5
α-helix	4259-4272	14
α-helix	4275-4278	4
β-strand	4283-4288	6	32
β-strand	4292-4295	4	32
α-helix	4296-4297	2
α-helix	4302-4310	9
α-helix	4318-4320	3
α-helix	4326-4344	19
α-helix	4376-4390	15
α-helix	4396-4398	3
α-helix	4402-4405	4
α-helix	4408-4439	32
α-helix	4446-4457	12
α-helix	4459-4461	3
α-helix	4462-4464	3
α-helix	4475-4499	25
α-helix	4500-4502	3
α-helix	4503-4506	4
β-strand	4509-4510	2	33
α-helix	4511-4513	3
α-helix	4517-4532	16
β-strand	4539-4545	7	33
α-helix	4551-4554	4
β-strand	4557-4561	5	33
β-strand	4564-4566	3	34
β-strand	4568-4571	4	34
β-strand	4574-4577	4	34
β-strand	4583-4584	2	34
β-strand	4588-4594	7	33
β-strand	4604-4610	7	34
β-strand	4618-4626	9	34
α-helix	4632-4637	6
β-strand	4641-4643	3	34

Chain F: 23 helices, 22 β-strands

Element	Residues	Length	Sheet
α-helix	11	1
β-strand	12-15	4	83
β-strand	20-25	6	83
β-strand	33-36	4	83
β-strand	39-42	4	84
α-helix	45	1
β-strand	46	1	85
β-strand	57-58	2	84
α-helix	60-64	5
β-strand	69-72	4	84
β-strand	75-76	2	86
β-strand	79-80	2	86
α-helix	83-93	11
β-strand	108-112	5	83
α-helix	113	1
α-helix	118-130	13
β-strand	136-141	6	83
α-helix	142-150	9
β-strand	155-160	6	69
β-strand	165-171	7	69
β-strand	174-175	2	69
β-strand	181-183	3	69
α-helix	187-201	15
α-helix	211-220	10
β-strand	223	1	87
α-helix	228-233	6
α-helix	235-236	2
β-strand	240-242	3	88
β-strand	248-250	3	88
α-helix	254-257	4
α-helix	259-262	4
α-helix	265-267	3
α-helix	275-284	10
α-helix	291-296	6
β-strand	298-301	4	69
α-helix	304-306	3
β-strand	308	1	87
α-helix	310-321	12
α-helix	323	1
β-strand	329-331	3	69
α-helix	339-349	11
α-helix	353-356	4
β-strand	358-359	2	83
α-helix	360-366	7
α-helix	368-373	6

34 more chain groups are not listed. Open the entry in the viewer and use the sequence panel to see them.

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
ARP1 actin related protein 1 homolog A	A, B, C, D, E, F, G, I	protein	376	Sus scrofa	F2Z5G5 (AlphaFold model)
Actin, cytoplasmic 1	H	protein	375	Sus scrofa	Q6QAQ1 (AlphaFold model)
Arp11	J	protein	417	Sus scrofa	I3LHK5 (AlphaFold model)
Capping protein (Actin filament) muscle Z-line, alpha 1	K	protein	286	Sus scrofa	A0PFK5 (AlphaFold model)
F-actin capping protein beta subunit	L	protein	272	Sus scrofa	A0PFK7
Dynactin subunit 2	M, N, P, Q	protein	405	Sus scrofa	A0A5G2QD80
Dynactin subunit 3	O, R	protein	186	Sus scrofa	F1SEC0
Dynactin subunit 1	S, T	protein	1281	Sus scrofa	A0A287B8J2
Dynactin 6	U	protein	190	Sus scrofa	D0G6S1
Dynactin subunit 5	V	protein	182	Sus scrofa	A0A286ZK88
BICD family-like cargo adapter 1	W, X, w, x	protein	577	Mus musculus	A0JNT9
Dynactin subunit 4	Y	protein	467	Sus scrofa	A0A4X1TB62

4 more molecules are not listed.

Sequence of entity 1 (A, B, C, D, E, F, G, I), FASTA

>7Z8F_1 ARP1 actin related protein 1 homolog A (chains A, B, C, D, E, F, G, I)
MESYDVIANQPVVIDNGSGVIKAGFAGDQIPKYCFPNYVGRPKHVRVMAGALEGDIFIGP
KAEEHRGLLSIRYPMEHGIVKDWNDMERIWQYVYSKDQLQTFSEEHPVLLTEAPLNPRKN
RERAAEVFFETFNVPALFISMQAVLSLYATGRTTGVVLDSGDGVTHAVPIYEGFAMPHSI
MRIDIAGRDVSRFLRLYLRKEGYDFHSSSEFEIVKAIKERACYLSINPQKDETLETEKAQ
YYLPDGSTIEIGPSRFRAPELLFRPDLIGEESEGIHEVLVFAIQKSDMDLRRTLFSNIVL
SGGSTLFKGFGDRLLSEVKKLAPKDVKIRISAPQERLYSTWIGGSILASLDTFKKMWVSK
KEYEEDGARSIHRKTF

Sequence of entity 2 (H), FASTA

>7Z8F_2 Actin, cytoplasmic 1 (chains H)
MDDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQS
KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT
QIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDL
AGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSY
ELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLS
GGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQ
EYDESGPSIVHRKCF

Sequence of entity 3 (J), FASTA

>7Z8F_3 Arp11 (chains J)
MPLYEGLGSGGEKTAVVIDLGEAFTKCGFAGETGPRCIIPSVIKKAGMPKPIKVVQYNIN
TEELYSYLKEFIHILYFRHLLVNPRDRRVVVIESVLCPSHFRETLTRVLFKYFEVPSVLL
APSHLMALLTLGINSAMVLDCGYRESLVLPIYEGIPVLNCWGALPLGGKALHKELETQLL
EQCTVDTGAAKEQSLPSVMGSIPEGVLEDIKVRTCFVSDLTRGLKIQAAKFNIDGNTERP
SPPPNVDYPLDGEKILHVLGSIRDSVVEILFEQDNEEKSVATLILDSLMQCPIDTRKQLA
ENLVIIGGTSMLPGFLHRLLAEIRYLVEKPKYKKTLGTKTFRIHTPPAKANCVAWLGGAI
FGALQDILGSRSVSKEYYNQTGRIPDWCSLNNPPLEMVFDVGKSQPPLMKRAFSTEK

Sequence of entity 4 (K), FASTA

>7Z8F_4 Capping protein (Actin filament) muscle Z-line, alpha 1 (chains K)
MADFEDRVSDEEKVRIAAKFITHAPPGEFNEVFNDVRLLLNNDNLLREGAAHAFAQYNMD
QFTPVKIEGYEDQVLITEHGDLGNSRFLDPRNKISFKFDHLRKEASDPQPEEVDGSLKSW
RESCDSALRAYVKDHYSNGFCTVYAKNIDGQQTIIACIESHQFQPKNFWNGRWRSEWKFT
ITPPTAQVVGVLKIQVHYYEDGNVQLVSHKDVQDSVTVSNEAQTAKEFIKIIEHAENEYQ
TAISENYQTMSDTTFKALRRQLPVTRTKIDWNKILSYKIGKEMQNA

Sequence of entity 5 (L), FASTA

>7Z8F_5 F-actin capping protein beta subunit (chains L)
MSDQQLDCALDLMRRLPPQQIEKNLSDLIDLVPSLCEDLLSSVDQPLKIARDKVVGKDYL
LCDYNRDGDSYRSPWSNKYDPPLEDGAMPSARLRKLEVEANNAFDQYRDLYFEGGVSSVY
LWDLDHGFAGVILIKKAGDGSKKIKGCWDSIHVVEVQEKSSGRTAHYKLTSTVMLWLQTN
KSGSGTMNLGGSLTRQMEKDETVSDCSPHIANIGRLVEDMENKIRSTLNEIYFGKTKDIV
NGLRSVQTFADKSKQEALKNDLVEALKRKQQC

Sequence of entity 6 (M, N, P, Q), FASTA

>7Z8F_6 Dynactin subunit 2 (chains M, N, P, Q)
MADPKYADLPGIARNEPDVYETSDLPEDDQAEFDAELEELTSTSVEHIIVNPNAAYDKFK
DKRVGTKGLDFSDRIGKTKRTGYESGEYEMLGEGLGVKETPQQKYQRLLHEVQELTTEVE
KIKMTVKESATEEKLTPVVLAKQLAALKQQLVASHLEKLLGPDAAINLTDPDGALAKRLL
LQLEATKNTKGAGSGGKTTSGSPPDSSLVTYELHSRPEQDKFSQAAKVAELEKRLTELEA
TVRCDQDAQNPLSAGLQGACLMETVELLQAKVSALDLAVLDQVEARLQSVLGKVNEIAKH
KASVEDADTQSKVHQLYETIQRWSPIASTLPELVQRLVTIKQLHEQAMQFGQLLTHLDTT
QQMIACSLKDNATLLTQVQTTMRENLSTVEGNFANIDERMKKLGK

Sequence of entity 7 (O, R), FASTA

>7Z8F_7 Dynactin subunit 3 (chains O, R)
MAGVTDVQRLQARLEELERWVYGPGGSRGSRKVADGLVKVQVALGNIASKRERVKILYKK
IEDLIKYLDPEYMDRIAIPDASKLQFILAEEQFILSQVALLEQVEALVPMLDSAHIKAVP
EHAARLQRLAQIHIQQQDQCVEITEESKALLEEYNKTTMLLSKQFVQWDELLCQLEAAKQ
VKPAEE

Sequence of entity 8 (S, T), FASTA

>7Z8F_8 Dynactin subunit 1 (chains S, T)
MAQSKRHVYSRTPSGSRMSAEASARPLRVGSRVEVIGKGHRGTVAYVGATLFATGKWVGV
ILDEAKGKNDGTVQGRKYFTCDEGHGIFVRQSQIQVFEDGADTTSPETPDSSASKVLRRE
GTDSNAKTSKLRGPKPKKAPTARKTTTRRPKPTRPASTGVAGASSSLGPSGSASAGELSS
SEPSTPAQTPLAAPIIPTPALTSPGAAPPLPSPSKEEEGLRAQVRDLEEKLETLRLKRAE
DKAKLKELEKHKIQLEQVQEWKSKMQEQQADLQRRLKEARKEAKEALEAKERYMEEMADT
ADAIEMATLDKEMAEERAESLQQEVEALKERVDELTTDLEILKAEIEEKGSDGAASSYQL
KQLEEQNARLKDALVRMRDLSSSEKQEHVKLQKLMEKKNQELEVVRQQRERLQEELSQAE
STIDELKEQVDAALGAEEMVEMLTDRNLNLEEKVRELRETVGDLEAMNEMNDELQENARE
TELELREQLDMAGARVREAQKRVEAAQETVADYQQTIKKYRQLTAHLQDVNRELTNQQEA
SVERQQQPPPETFDFKIKFAETKAHAKAIEMELRQMEVAQANRHMSLLTAFMPDSFLRPG
GDHDCVLVLLLMPRLICKAELIRKQAQEKFDLSENCSERPGLRGAAGEQLSFAAGLVYSL
SLLQATLHRYEHALSQCSVDVYKKVGSLYPEMSAHERSLDFLIELLHKDQLDETVNVEPL
TKAIKYYQHLYSIHLAEQPEDSTMQLADHIKFTQSALDCMSVEVGRLRAFLQGGQEASDI
ALLLRDLETSCSDIRQFCKKIRRRMPGTDAPGIPAALAFGAQVSDTLLDCRKHLTWVVAV
LQEVAAAAAQLIAPLAENEGLPVAALEELAFKASEQIYGTPSSSPYECLRQSCNILISTM
NKLATAMQEGEYDAERPPSKPPPVELRAAALRAEITDAEGLGLKLEDRETVIKELKKSLK
IKGEELSEANVRLSLLEKKLDSAAKDADERIEKVQTRLEETQALLRKKEKEFEETMDALQ
ADIDQLEAEKAELKQRLNSQSKRTIEGIRGPPPSGIATLVSGIAGEEQQRGGAPGQAPGI
VPGPGLVKDSPLLLQQISAMRLHISQLQHENSVLKGAQMKASLAALPPLHVAKLSLPPHE
GPGSELAAGALYRKTNQLLETLNQLSTHTHVVDITRSSPAAKSPSAQLLEQVTQLKSLSD
TIEKLKDEVLKETVSQRPGATVPTDFATFPSSAFLRAKEEQQDDTVYMGKVTFSCAAGLG
QRHRLVLTQEQLHQLHDRLIS

Sequence of entity 9 (U), FASTA

>7Z8F_9 Dynactin 6 (chains U)
MAEKTQKSVKIAPGAVVCVESEIRGDVTIGPRTVIHPKARIIAEAGPIVIGEGNLIEEQA
LIINAHPDNITPDAEDSEPKPMIIGTNNVFEVGCYSQAMKMGDNNVIESKAYVGRNVILT
SGCIIGACCNLNTFEVIPENTVIYGADCLRRVQTERPQPQTLQLDFLMKILPNYHHLKKT
MKGSSTPVKN

Sequence of entity 10 (V), FASTA

>7Z8F_10 Dynactin subunit 5 (chains V)
MELGELLYNKSEYIETASGNKVSRQSVLCGSQNIVLNGKTIVMNDCIIRGDLANVRVGRH
CVVKSRSVIRPPFKKFSKGVAFFPLHIGDHVFIEEDCVVNAAQIGSYVHVGKNCVIGRRC
VLKDCCKILDNTVLPPETVVPPFTVFSGCPGLFSGELPECTQELMIDVTKSYYQKFLPLT
QV

Sequence of entity 11 (W, X, w, x), FASTA

>7Z8F_11 BICD family-like cargo adapter 1 (chains W, X, w, x)
MSAFCLGLAGRASAPAEPDSACCMELPAGAGDAVRSPATAAALVSFPGGPGELELALEEE
LALLAAGERSSEPGEHPQAEPESPVEGHGPPLPPPPTQDPELLSVIRQKEKDLVLAARLG
KALLERNQDMSRQYEQMHKELTDKLEHLEQEKHELRRRFENREGEWEGRVSELETDVKQL
QDELERQQLHLREADREKTRAVQELSEQNQRLLDQLSRASEVERQLSMQVHALKEDFREK
NSSTNQHIIRLESLQAEIKMLSDRKRELEHRLSATLEENDLLQGTVEELQDRVLILERQG
HDKDLQLHQSQLELQEVRLSYRQLQGKVEELTEERSLQSSAATSTSLLSEIEQSMEAEEL
EQEREQLRLQLWEAYCQVRYLCSHLRGNDSADSAVSTDSSMDESSETSSAKDVPAGSLRT
ALNDLKRLIQSIVDGVEPTVTLLSVEMTALKEERDRLRVTSEDKEPKEQLQKAIRDRDEA
IAKKNAVELELAKCKMDMMSLNSQLLDAIQQKLNLSQQLEAWQDDMHRVIDRQLMDTHLK
EQSRPAAAAFPRGHGVGRGQEPSTADGKRLFSFFRKI

Sequence of entity 12 (Y), FASTA

>7Z8F_12 Dynactin subunit 4 (chains Y)
MASLLQSERVLYLVQGEKKVRAPLSQLYFCRYCSELRSLECVSHEVDSHYCPSCLENMPS
AEAKLKKNRCANCFDCPGCMHTLSTRATSISTQLPDDPAKTAVKKAYYLACGFCRWTSRD
VGMADKSVASGGWQEPDHPHTQRMNKLIEYYQQLAQKEKVERDRKKLARRRNYMPLAFSQ
HTIHVVDKYGLGTRLQRPRAGTTITALAGLSLKEGEDQKEIKIEPAQAVDEVEPLPEDYY
TRPVNLTEVTTLQQRLLQPDFQPICASQLYPRHKHLLIKRSLRCRQCEHNLSKPEFNPTS
IKFKIQLVAVNYIPEVRIMSIPNLRYMKESQVLLTLTNPVENLTHVTLLECEEGDPDDTN
STAKVSVPPTELVLAGKDAAAEYDELAEPQDFPDDPDVVAFRKANKVGVFIKVTPQREEG
DVTVCFKLKHDFKNLAAPIRPVEEADPGAEVSWLTQHVELSLGPLLP

Ligands and cofactors

ID	Name	Formula	Copies
ADP	Adenosine-5'-diphosphate	C10 H15 N5 O10 P2	13
MG	Magnesium ion	Mg	14
ATP	Adenosine-5'-triphosphate	C10 H16 N5 O13 P3	5
ZN	Zinc ion	Zn	3
ANP	Phosphoaminophosphonic acid-adenylate ester	C10 H17 N6 O12 P3	8

Primary citation

Structure of dynein-dynactin on microtubules shows tandem adaptor binding. Chaaban, S., Carter, A.P. Nature (2022) 610:212-216. DOI 10.1038/s41586-022-05186-y · PubMed

Other PDB entries of the same protein (UniProt F2Z5G5 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7Z8I 3.3 Å, The barbed end complex of dynactin bound to BICDR1 and the cytoplasmic dynein tails (A2,…
6F1U 3.4 Å, N terminal region of dynein tail domains in complex with dynactin filament and BICDR-1
6F1T 3.5 Å, Cryo-EM structure of two dynein tail domains bound to dynactin and BICDR1
6ZNL 3.8 Å, Cryo-EM structure of the dynactin complex
5ADX 4.0 Å, CryoEM structure of dynactin complex at 4.0 angstrom resolution
6ZNM 4.1 Å, The pointed end complex of dynactin bound to BICDR1
7Z8K 4.37 Å, Cytoplasmic dynein (A1) bound to BICDR1
6ZNN 4.5 Å, The pointed end complex of dynactin bound to Hook3
9HHL 6.53 Å, Structure of Dynein-Dynactin-NuMA-LIS1
6F38 6.7 Å, Cryo-EM structure of two dynein tail domains bound to dynactin and HOOK3
6ZNO 6.8 Å, The pointed end complex of dynactin with the p150 projection docked
5AFU 8.2 Å, Cryo-EM structure of dynein tail-dynactin-BICD2N complex

Browse structure collections

About this viewer

MolViewer shows 7Z8F directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.