7ZBQ: TccC3

Name: PDB 7ZBQ: Structure of the ADP-ribosyltransferase TccC3HVR from Photorhabdus Luminescens
Published: 2022-06-29
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: toxin

Structure of the ADP-ribosyltransferase TccC3HVR from Photorhabdus Luminescens. Determined by solution NMR. Released 29 Jun 2022.

Method: Solution NMR
Organism: Photorhabdus luminescens
Chains: 1
Atoms: 1,419
Mol. weight: 21.72 kDa
Released: 29 Jun 2022

Explore 7ZBQ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7ZBQ contains 7 α-helices and 12 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	106-114	9	1
α-helix	119-124	6
β-strand	129-130	2	2
α-helix	138-145	8
α-helix	146-149	4
α-helix	159-167	9
α-helix	174-183	10
β-strand	192-195	4	1
α-helix	207-208	2
β-strand	209-221	13	1
β-strand	226-228	3	1
β-strand	235	1	3
β-strand	238	1	3
β-strand	240-243	4	1
α-helix	248-250	3
β-strand	254-258	5	1
β-strand	265-268	4	1
β-strand	272-273	2	2
β-strand	277-278	2	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
TccC3	A	protein	194	Photorhabdus luminescens	Q8GF97 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>7ZBQ_1 TccC3 (chains A)
MSTTSTNLQKKSFTLYRADNRSFEEMQSKFPEGFKAWTPLDTKMARQFASIFIGQKDTSN
LPKETVKNISTWGAKPKLKDLSNYIKYTKDKSTVWVSTAINTEAGGQSSGAPLHKIDMDL
YEFAIDGQKLNPLPEGRTKNMVPSLLLDTPQIETSSIIALNHGPVNDAEISFLTTIPLKN
VKPHKRGTLEVLFQ

Primary citation

Mechanism of threonine ADP-ribosylation of F-actin by a Tc toxin. Belyy, A., Lindemann, F., Roderer, D. et al. Nat Commun (2022) 13:4202-4202. DOI 10.1038/s41467-022-31836-w · PubMed

Other PDB entries of the same protein (UniProt Q8GF97 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6SUP 2.0 Å, Crystal Structure of TcdB2-TccC3-Cdc42
4O9X 2.17 Å, Crystal Structure of TcdB2-TccC3
6H6G 3.0 Å, Crystal Structure of TcdB2-TccC3 without hypervariable C-terminal region
6SUE 3.4 Å, Structure of Photorhabdus luminescens Tc holotoxin pore, Mutation TccC3-D651A
6SUF 3.4 Å, Structure of Photorhabdus luminescens Tc holotoxin pore
6SUQ 3.7 Å, Crystal Structure of TcdB2-TccC3-TEV
6H6F 3.72 Å, PTC3 holotoxin complex from Photorhabdus luminiscens - Mutant TcC-D651A
7Z7H 3.8 Å, Structure of P. luminescens TccC3-F-actin complex
6H6E 3.95 Å, PTC3 holotoxin complex from Photorhabdus luminecens in prepore state (TcdA1, TcdB2, TccC3)

Browse structure collections

About this viewer

MolViewer shows 7ZBQ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.