7ZV1: Aichivirus A 2A protein L64M, L109M mutant

Crystal Structure of Aichivirus A 2A protein L64M, L109M mutant. Determined by X-ray diffraction at 1.74 Å resolution. Released 31 May 2023.

Method: X-ray diffraction
Resolution: 1.74 Å
Organism: Aichi virus A846/88
Chains: 3
Atoms: 2,607
Mol. weight: 43.41 kDa
Released: 31 May 2023

Explore 7ZV1 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7ZV1 contains 13 α-helices and 27 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 9 β-strands

Element	Residues	Length	Sheet
β-strand	14-21	8	1
β-strand	26-33	8	1
β-strand	39-47	9	1
β-strand	50-56	7	1
β-strand	61-66	6	1
α-helix	68-75	8
β-strand	81-82	2	1
β-strand	85	1	2
β-strand	88	1	2
α-helix	90-98	9
α-helix	112-115	4
α-helix	117	1
β-strand	118	1	1

Chain B: 5 helices, 9 β-strands

Element	Residues	Length	Sheet
β-strand	14-21	8	3
β-strand	26-33	8	3
β-strand	39-47	9	3
β-strand	50-56	7	3
β-strand	61-66	6	3
α-helix	69-75	7
β-strand	81-82	2	3
β-strand	85	1	4
β-strand	88	1	4
α-helix	90-98	9
α-helix	112-115	4
α-helix	117	1
β-strand	118	1	3
α-helix	119	1

Chain C: 4 helices, 9 β-strands

Element	Residues	Length	Sheet
β-strand	14-21	8	5
β-strand	26-33	8	5
β-strand	39-47	9	5
β-strand	50-56	7	5
β-strand	61-66	6	5
α-helix	68-75	8
β-strand	81-82	2	5
β-strand	85	1	6
β-strand	88	1	6
α-helix	90-98	9
α-helix	117	1
β-strand	118	1	5
α-helix	119	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Protein 2A	A, B, C	protein	136	Aichi virus A846/88	O91464 (AlphaFold model)

Sequence of entity 1 (A, B, C), FASTA

>7ZV1_1 Protein 2A (chains A, B, C)
GAASATPDVDPDDRVYIVRAQRPTYVHWAIRKVAPDGSAKQISLSRSGIQALVALEPPEG
EPYMEILPSHWTLAELQLGNKWEYSATNNCTHFVSSITGESLPNTGFSMALGIGALTAIA
ASAAVAVKALPGIRRQ

Primary citation

Structural and functional repurposing of picornavirus H/NC-motif 2A proteins. von Castelmur, E., Perrakis, A. To be published.

Other PDB entries of the same protein (UniProt O91464 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5AOO 2.1 Å, X-ray structure of a human Kobuvirus: Aichi virus A (AiV)
7ZV6 2.83 Å, Crystal Structure of Aichivirus A 2A protein
5LZ3 3.0 Å, Crystal structure of human ACBD3 GOLD domain in complex with 3A protein of Aichivirus A
5GKA 3.7 Å, cryo-EM structure of human Aichi virus
5LVC 4.2 Å, Aichi virus 1: empty particle

Browse structure collections

About this viewer

MolViewer shows 7ZV1 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.