5LZ3: Human ACBD3 GOLD domain

Crystal structure of human ACBD3 GOLD domain in complex with 3A protein of Aichivirus A. Determined by X-ray diffraction at 3.0 Å resolution. Released 14 Dec 2016.

Method: X-ray diffraction
Resolution: 3.0 Å
Organisms: Homo sapiens, Aichi virus
Chains: 2
Atoms: 1,301
Mol. weight: 25.87 kDa
Released: 14 Dec 2016

Explore 5LZ3 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5LZ3 contains 4 α-helices and 10 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 9 β-strands

Element	Residues	Length	Sheet
α-helix	370-372	3
β-strand	373-377	5	1
α-helix	380-388	9
β-strand	394-397	4	1
β-strand	402-408	7	2
α-helix	409-410	2
β-strand	415-421	7	1
β-strand	427-435	9	2
β-strand	476-485	10	2
β-strand	491-497	7	1
β-strand	502-509	8	2
β-strand	518-527	10	1

Chain B: 1 helix, 1 β-strand

Element	Residues	Length	Sheet
β-strand	3-6	4	2
α-helix	18-26	9

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Golgi resident protein GCP60	A	protein	166	Homo sapiens	Q9H3P7 (AlphaFold model)
3A	B	protein	58	Aichi virus	O91464 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>5LZ3_1 Golgi resident protein GCP60 (chains A)
MESLPVIAAPSMWTRPQIKDFKEKIQQDADSVITVGRGEVVTVRVPTHEEGSYLFWEFAT
DNYDIGFGVYFEWTDSPNTAVSVHVSESSDDDEEEEENIGCEEKAKKNANKPLLDEIVPV
YRRDCHEEVYAGSHQYPGRGVYLLKFDNSYSLWRSKSVYYRVYYTR

Sequence of entity 2 (B), FASTA

>5LZ3_2 3A (chains B)
GNRVIDAEPREIPLEYADDLLEAMAHHRPVPCSLGLSQAIANNTPIQQISETFWKYRK

Primary citation

Kobuviral Non-structural 3A Proteins Act as Molecular Harnesses to Hijack the Host ACBD3 Protein. Klima, M., Chalupska, D., Rozycki, B. et al. Structure (2017) 25:219-230. DOI 10.1016/j.str.2016.11.021 · PubMed

Other PDB entries of the same protein (UniProt Q9H3P7 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5LZ1 2.0 Å, Crystal structure of human ACBD3 GOLD domain
6HLN 2.1 Å, Crystal structure of human ACBD3 GOLD domain in complex with 3A protein of enterovirus-D68
6HMV 2.24 Å, Crystal structure of human ACBD3 GOLD domain in complex with 3A protein of…
6HM8 2.28 Å, Crystal structure of human ACBD3 GOLD domain in complex with 3A protein of…
5TDQ 2.49 Å, Crystal Structure of the GOLD domain of ACBD3
6HLV 2.5 Å, Crystal structure of human ACBD3 GOLD domain in complex with 3A protein of poliovirus-1…
5LZ6 2.6 Å, Crystal structure of human ACBD3 GOLD domain in complex with 3A protein of Aichivirus B
6HLW 2.73 Å, Crystal structure of human ACBD3 GOLD domain in complex with 3A protein of…
6HLT 2.81 Å, Crystal structure of human ACBD3 GOLD domain in complex with 3A protein of rhinovirus-14…
2N72 Solution structure of the Q domain from ACBD3
2N73 Solution structure of the ACBD3:PI4KB complex

Browse structure collections

About this viewer

MolViewer shows 5LZ3 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.