7ZV6: Aichivirus A 2A protein

Crystal Structure of Aichivirus A 2A protein. Determined by X-ray diffraction at 2.83 Å resolution. Released 24 May 2023.

Method: X-ray diffraction
Resolution: 2.83 Å
Organism: Aichi virus A846/88
Chains: 3
Atoms: 2,645
Mol. weight: 43.93 kDa
Released: 24 May 2023

Explore 7ZV6 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7ZV6 contains 15 α-helices and 27 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 9 β-strands

Element	Residues	Length	Sheet
β-strand	14-21	8	3
β-strand	26-33	8	3
β-strand	39-47	9	3
β-strand	50-56	7	3
β-strand	61-66	6	3
α-helix	69-75	7
β-strand	81-82	2	3
β-strand	85	1	4
β-strand	88	1	4
α-helix	90-98	9
α-helix	112-115	4
α-helix	117	1
β-strand	118	1	3
α-helix	119	1

Chain B: 6 helices, 9 β-strands

Element	Residues	Length	Sheet
α-helix	9-10	2
β-strand	14-21	8	1
β-strand	26-33	8	1
β-strand	39-47	9	1
β-strand	50-56	7	1
β-strand	61-66	6	1
α-helix	69-75	7
β-strand	81-82	2	1
β-strand	85	1	2
β-strand	88	1	2
α-helix	90-98	9
α-helix	112-115	4
α-helix	117	1
β-strand	118	1	1
α-helix	119-120	2

Chain C: 4 helices, 9 β-strands

Element	Residues	Length	Sheet
β-strand	14-21	8	5
β-strand	26-33	8	5
β-strand	39-47	9	5
β-strand	50-56	7	5
β-strand	61-66	6	5
α-helix	69-75	7
β-strand	81-82	2	5
β-strand	85	1	6
β-strand	88	1	6
α-helix	90-98	9
α-helix	112-115	4
α-helix	117	1
β-strand	118	1	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Protein 2A	A, B, C	protein	139	Aichi virus A846/88	O91464 (AlphaFold model)

Sequence of entity 1 (A, B, C), FASTA

>7ZV6_1 Protein 2A (chains A, B, C)
GPGGAASATPDVDPDDRVYIVRAQRPTYVHWAIRKVAPDGSAKQISLSRSGIQALVALEP
PEGEPYLEILPSHWTLAELQLGNKWEYSATNNCTHFVSSITGESLPNTGFSLALGIGALT
AIAASAAVAVKALPGIRRQ

Primary citation

Structural and functional repurposing of picornavirus H/NC-motif 2A proteins. von Castelmur, E., Perrakis, A. To be published.

Other PDB entries of the same protein (UniProt O91464 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7ZV1 1.74 Å, Crystal Structure of Aichivirus A 2A protein L64M, L109M mutant
5AOO 2.1 Å, X-ray structure of a human Kobuvirus: Aichi virus A (AiV)
5LZ3 3.0 Å, Crystal structure of human ACBD3 GOLD domain in complex with 3A protein of Aichivirus A
5GKA 3.7 Å, cryo-EM structure of human Aichi virus
5LVC 4.2 Å, Aichi virus 1: empty particle

Browse structure collections

About this viewer

MolViewer shows 7ZV6 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.