8AEL: Synaptojanin-2-binding protein,Annexin A2

SYNJ2BP complex with a synthetic Vangl2 peptide (3mer). Determined by X-ray diffraction at 2.2 Å resolution. Released 16 Aug 2023.

Method: X-ray diffraction
Resolution: 2.2 Å
Organism: Homo sapiens
Chains: 2
Atoms: 3,581
Mol. weight: 48.24 kDa
Ligands: CA
Released: 16 Aug 2023

Explore 8AEL in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8AEL contains 24 α-helices and 9 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 24 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	8-17	10	1
β-strand	19	1	2
β-strand	22	1	2
β-strand	25-29	5	1
β-strand	42-47	6	1
α-helix	52-56	5
β-strand	64-68	5	1
β-strand	71-72	2	1
α-helix	78-86	9
β-strand	91-100	10	1
α-helix	118-130	13
α-helix	136-143	8
α-helix	148-162	15
α-helix	166-173	8
α-helix	176-186	11
α-helix	189-200	12
α-helix	203-205	3
α-helix	208-217	10
α-helix	220-234	15
α-helix	238-243	6
α-helix	248-258	11
α-helix	262-264	3
α-helix	271-284	14
α-helix	293-302	10
α-helix	305-318	14
α-helix	323-330	8
α-helix	333-347	15
α-helix	349-362	14
α-helix	368-377	10
α-helix	383-394	12
α-helix	398-405	8
α-helix	408-418	11

Chain B: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	37-38	2	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Synaptojanin-2-binding protein,Annexin A2	A	protein	417	Homo sapiens	P07355 (AlphaFold model), P57105 (AlphaFold model)
Gly-gly-gly-thr-ser-val	B	protein	6	Homo sapiens

Sequence of entity 1 (A), FASTA

>8AEL_1 Synaptojanin-2-binding protein,Annexin A2 (chains A)
LYLVTEEEINLTRGPSGLGFNIVGGTDQQYVSNDSGIYVSRIKENGAAALDGRLQEGDKI
LSVNGQDLKNLLHQDAVDLFRNAGYAVSLRVQHRLQVQGSAYGSVKAYTNFDAERDALNI
ETAIKTKGVDEVTIVNILTNRSNEQRQDIAFAYQRRTKKELASALKSALSGHLETVILGL
LKTPAQYDASELKASMKGLGTDEDSLIEIICSRTNQELQEINRVYKEMYKTDLEKDIISD
TSGDFRKLMVALAKGRRAEDGSVIDYELIDQDARDLYDAGVKRKGTDVPKWISIMTERSV
PHLQKVFDRYKSYSPYDMLESIRKEVKGDLENAFLNLVQCIQNKPLYFADRLYDSMKGKG
TRDKVLIRIMVSRSEVDMLKIRSEFKRKYGKSLYYYIQQDTKGDYQKALLYLCGGDD

Sequence of entity 2 (B), FASTA

>8AEL_2 GLY-GLY-GLY-THR-SER-VAL (chains B)
GGGTSV

Ligands and cofactors

ID	Name	Formula	Copies
CA	Calcium ion	Ca	4

Water and common crystallization additives (GOL) are not listed.

Primary citation

SYNJ2BP PDZ domain in complex with a synthetic Vangl2 peptide. Carrasco, K., Cousido Siah, A., Gogl, G. et al. To be published.

Other PDB entries of the same protein (UniProt P07355 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2HYV 1.42 Å, Human Annexin A2 with heparin hexasaccharide bound
1W7B 1.52 Å, Annexin A2: Does it induce membrane aggregation by a new multimeric state of the protein.
7QQM 1.6 Å, The PDZ domain of LRRC7 fused with ANXA2
7PC5 1.7 Å, The third PDZ domain of PDZD7 complexed with the PDZ-binding motif of EXOC4
7P73 1.85 Å, The PDZ domain of SYNJ2BP complexed with the PDZ-binding motif of HTLV1-TAX1
2HYU 1.86 Å, Human Annexin A2 with heparin tetrasaccharide bound
7ZVN 1.87 Å, Crystal structure of human Annexin A2 in complex with full phosphorothioate 5-10…
5LPX 1.9 Å, Crystal structure of PKC phosphorylation-mimicking mutant (S26E) Annexin A2
7P74 1.9 Å, The PDZ domain of SYNJ2BP complexed with the phosphorylated PDZ-binding motif of RSK1
7PC3 1.95 Å, The second PDZ domain of DLG1 complexed with the PDZ-binding motif of HTLV1-TAX1
7P70 2.0 Å, The PDZ-domain of SNTB1 complexed with the PDZ-binding motif of HPV35-E6
7PCB 2.0 Å, The PDZ domain of SNX27 fused with ANXA2

Browse structure collections

About this viewer

MolViewer shows 8AEL directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.