8AZ4: IAPP S20G plateau-phase fibril polymorph 2PF-L
IAPP S20G plateau-phase fibril polymorph 2PF-L. Determined by electron microscopy at 2.2 Å resolution. Released 10 Jan 2024.
- Method
- Electron microscopy
- Resolution
- 2.2 Å
- Organism
- Homo sapiens
- Chains
- 10
- Atoms
- 2,280
- Mol. weight
- 38.77 kDa
- Released
- 10 Jan 2024
Explore 8AZ4 in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
8AZ4 contains 0 α-helices and 40 β-strands across 10 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chains A, B, C, D, E, F, G, H, I and J: 0 helices, 4 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 11-22 | 12 | 1 |
| β-strand | 25-26 | 2 | 2 |
| β-strand | 29-32 | 4 | 3 |
| β-strand | 36 | 1 | 4 |
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| Islet amyloid polypeptide | A, B, C, D, E, F, G, H, I, J | protein | 38 | Homo sapiens | P10997 (AlphaFold model) |
Sequence of entity 1 (A, B, C, D, E, F, G, H, I, J), FASTA
>8AZ4_1 Islet amyloid polypeptide (chains A, B, C, D, E, F, G, H, I, J)
KCNTATCATQRLANFLVHSGNNFGAILSSTNVGSNTYX
Primary citation
Structural evolution of fibril polymorphs during amyloid assembly. Wilkinson, M., Xu, Y., Thacker, D. et al. Cell (2023) 186:5798-5811.e26. DOI 10.1016/j.cell.2023.11.025 · PubMed
Other PDB entries of the same protein (UniProt P10997 (AlphaFold model), which also has an AlphaFold model), best resolution first:
- 8YG2 1.25 Å, Crystal structure of amyloidogenic peptide Piv-NFGAIL-NH2 from Islet Amyloid Polypeptide
- 5KO0 1.4 Å, Human Islet Amyloid Polypeptide Segment 15-FLVHSSNNFGA-25 Determined by MicroED
- 3FPO 1.5 Å, HSSNNF segment from Islet Amyloid Polypeptide (IAPP or Amylin)
- 3FTK 1.5 Å, NVGSNTY segment from Islet Amyloid Polypeptide (IAPP or Amylin), hydrated crystal form
- 3FTL 1.6 Å, NVGSNTY segment from Islet Amyloid Polypeptide (IAPP or Amylin), dehydrated crystal form
- 3FTR 1.61 Å, Structure of an amyloid forming peptide SSTNVG from IAPP (alternate polymorph)
- 3DG1 1.66 Å, Segment SSTNVG derived from IAPP
- 3G7W 1.75 Å, Islet Amyloid Polypeptide (IAPP or Amylin) Residues 1 to 22 fused to Maltose Binding…
- 3FTH 1.84 Å, NFLVHSS segment from Islet Amyloid Polypeptide (IAPP or Amylin)
- 3FR1 1.85 Å, NFLVHS segment from Islet Amyloid Polypeptide (IAPP or Amylin)
- 3G7V 1.86 Å, Islet Amyloid Polypeptide (IAPP or Amylin) fused to Maltose Binding Protein
- 9CC5 1.87 Å, De novo design of high-affinity protein binders to bio active peptide Amylin
Browse structure collections
About this viewer
MolViewer shows 8AZ4 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.