8CR8: Human Interleukin-23

human Interleukin-23. Determined by X-ray diffraction at 2.0 Å resolution. Released 7 Feb 2024.

Method: X-ray diffraction
Resolution: 2.0 Å
Organism: Homo sapiens
Chains: 2
Atoms: 3,595
Mol. weight: 59.59 kDa
Ligands: TB
Released: 7 Feb 2024

Explore 8CR8 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8CR8 contains 15 α-helices and 27 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 27 β-strands

Element	Residues	Length	Sheet
β-strand	23-27	5	1
β-strand	30-36	7	1
β-strand	44-47	4	2
β-strand	59-62	4	1
β-strand	65	1	1
β-strand	71	1	1
β-strand	76-79	4	2
α-helix	82-84	3
β-strand	86-92	7	1
β-strand	95-108	14	1
β-strand	111-112	2	1
α-helix	113	1
β-strand	130-132	3	1
β-strand	133	1	3
β-strand	139-146	8	1
β-strand	152-160	9	1
α-helix	165	1
β-strand	166-170	5	1
β-strand	174-181	8	1
β-strand	184-195	12	1
α-helix	203-204	2
β-strand	208-216	9	1
β-strand	219-227	9	1
α-helix	229-232	4
β-strand	233	1	3
α-helix	235-238	4
β-strand	239-245	7	4
β-strand	251-257	7	4
β-strand	271-279	9	5
β-strand	286-291	6	5
β-strand	295-299	5	4
β-strand	304-312	9	5
α-helix	318-322	5
β-strand	323-326	4	5

Chain B: 8 helices, 0 β-strands

Element	Residues	Length
α-helix	30-47	18
α-helix	73-75	3
α-helix	79-84	6
α-helix	87-104	18
α-helix	107-110	4
α-helix	114-116	3
α-helix	121-135	15
α-helix	159-186	28

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Interleukin-12 subunit beta	A	protein	325	Homo sapiens	P29460 (AlphaFold model)
Interleukin-23 subunit alpha	B	protein	196	Homo sapiens	Q9NPF7 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>8CR8_1 Interleukin-12 subunit beta (chains A)
MGVKVLFALICIAVAEALEIWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLD
QSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKEP
KNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERVRGD
NKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQL
KPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKSKREKKDRVFTDKTSATVICRKD
ASISVRAQDRYYSSSWSEWASVPCS

Sequence of entity 2 (B), FASTA

>8CR8_2 Interleukin-23 subunit alpha (chains B)
MGWSCIILFLVATATGVHSSRNVPGGSSPAWTQCQQLSQKLCTLAWSAHPLVGHMDLREE
GDEETTNDVPHIQCGDGCDPQGLRDNSQFCLQRIHQGLIFYEKLLGSDIFTGEPSLLPDS
PVGQLHASLLGLSQLLQPEGHHWETQQIPSLSPSQPWQRLLLRFKILRSLQAFVAVAARV
FAHGAATLSPHHHHHH

Ligands and cofactors

ID	Name	Formula	Copies
TB	Terbium(iii) ion	Tb	1

Primary citation

Structures of complete extracellular receptor assemblies mediated by IL-12 and IL-23. Bloch, Y., Felix, J., Merceron, R. et al. Nat Struct Mol Biol (2024) 31:591-597. DOI 10.1038/s41594-023-01190-6 · PubMed

Other PDB entries of the same protein (UniProt P29460 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5MJ3 1.74 Å, Interleukin-23 complex with an antagonistic alphabody, crystal form 1
3D85 1.9 Å, Crystal structure of IL-23 in complex with neutralizing FAB
3DUH 2.3 Å, Structure of Interleukin-23
8UUI 2.43 Å, X-ray structure of Interleukin-23 in complex with peptide 23-446
1F42 2.5 Å, The P40 domain of human interleukin-12
5MXA 2.5 Å, Structure of unbound Interleukin-23
4GRW 2.55 Å, Structure of a complex of human IL-23 with 3 Nanobodies (Llama vHHs)
6UIB 2.74 Å, Crystal structure of IL23 bound to peptide 23-652
1F45 2.8 Å, Human interleukin-12
5MZV 2.8 Å, IL-23:IL-23R:Nb22E11 complex
3D87 2.9 Å, Crystal structure of Interleukin-23
3HMX 3.0 Å, Crystal structure of ustekinumab FAB/IL-12 complex

Browse structure collections

About this viewer

MolViewer shows 8CR8 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.