8CV5: Peptide 4.2B

Peptide 4.2B in complex with BRD3.2. Determined by X-ray diffraction at 1.47 Å resolution. Released 24 May 2023.

Method: X-ray diffraction
Resolution: 1.47 Å
Organisms: Homo sapiens, synthetic construct
Chains: 2
Atoms: 1,248
Mol. weight: 16.08 kDa
Ligands: NH2, ACE
Released: 24 May 2023

Explore 8CV5 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8CV5 contains 11 α-helices and 2 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 10 helices, 0 β-strands

Element	Residues	Length
α-helix	310-322	13
α-helix	325-327	3
α-helix	328-331	4
α-helix	332-334	3
α-helix	340-343	4
α-helix	348-351	4
α-helix	358-366	9
α-helix	373-390	18
α-helix	396-414	19
α-helix	416-417	2

Chain B: 1 helix, 2 β-strands

Element	Residues	Length	Sheet
β-strand	2	1	1
α-helix	4-10	7
β-strand	15	1	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Bromodomain-containing protein 3	A	protein	118	Homo sapiens	Q15059 (AlphaFold model)
Peptide 4.2E	B	protein	17	synthetic construct

Sequence of entity 1 (A), FASTA

>8CV5_1 Bromodomain-containing protein 3 (chains A)
GPLGSKLSEHLRYCDSILREMLSKKHAAYAWPFYKPVDAEALELHDYHDIIKHPMDLSTV
KRKMDGREYPDAQGFAADVRLMFSNCYKYNPPDHEVVAMARKLQDVFEMRFAKMPDEP

Sequence of entity 2 (B), FASTA

>8CV5_2 Peptide 4.2E (chains B)
WYDVFLTRKYGKKKVAC

Ligands and cofactors

ID	Name	Formula	Copies
NH2	Amino group	H2 N	1
ACE	Acetyl group	C2 H4 O	1

Primary citation

Discovery and characterization of cyclic peptides selective for the C-terminal bromodomains of BET family proteins. Franck, C., Patel, K., Walport, L.J. et al. Structure (2023) 31:912-923.e4. DOI 10.1016/j.str.2023.05.009 · PubMed

Other PDB entries of the same protein (UniProt Q15059 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6QJU 1.2 Å, Crystal structure of human Bromodomain containing protein 3 (BRD3) in complex with…
3S92 1.36 Å, Crystal Structure of the second bromodomain of human BRD3 in complex with the inhibitor…
9NN4 1.37 Å, BET BRD3-BD1 in complex with peptide 7.2
2NXB 1.4 Å, Crystal structure of human Bromodomain containing protein 3 (BRD3)
7TOA 1.41 Å, BRD3-BD1 in complex with RaPID linear peptide 3xAcK.1 (triAcK.1)
7LAY 1.45 Å, Crystal structure of the first bromodomain (BD1) of human BRD3 bound to SG3-179
7L72 1.5 Å, Crystal structure of the second bromodomain (BD2) of human BRD3 bound to Ro3280
7RJL 1.5 Å, Crystal structure of human Bromodomain containing protein 3 (BRD3) in complex with SHMT
7TO8 1.5 Å, BRD3-BD1 in complex with RaPID linear peptide 2xAcK.1 (diAcK.1)
7L9L 1.55 Å, Crystal structure of the second bromodomain (BD2) of human BRD3 bound to BI2536
7TO9 1.6 Å, BRD3-BD1 in complex with RaPID linear peptide 2xAcK.4xE (diAcK.4xE)
9MPN 1.6 Å, BRD3-BD1 A128T mutant

Browse structure collections

About this viewer

MolViewer shows 8CV5 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.