The structure of Interleukin-11 Mutein. Determined by X-ray diffraction at 1.8 Å resolution. Released 29 Nov 2023.
Explore 8DPW in 3D Show helices and sheets RCSB PDB PDBe
8DPW contains 8 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 14-42 | 29 | |
| α-helix | 51-53 | 3 | |
| α-helix | 58-60 | 3 | |
| α-helix | 69-93 | 25 | |
| α-helix | 96-101 | 6 | |
| α-helix | 102-125 | 24 | |
| α-helix | 128-143 | 16 | |
| α-helix | 146-175 | 30 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Interleukin-11 | A | protein | 169 | Homo sapiens | P20809 (AlphaFold model) |
>8DPW_1 Interleukin-11 (chains A) GSPDPRAELDSTVLLTRSLLADTRQLAAQLRDKFPADGDHNLDSLPTLPAIDYALGALQL PGVLTRLRADLLSYLRHVQWLRRAGGSSLKTLEPELGTLQARLDRLLRRLQLLMSRLALP QPPPDPPAPPLAPPSSAAGGIRAAHAILGGLHLTLDWAVRGLLLLKTRL
Structures of the interleukin 11 signalling complex reveal gp130 dynamics and the inhibitory mechanism of a cytokine variant. Metcalfe, R.D., Hanssen, E., Fung, K.Y. et al. Nat Commun (2023) 14:7543-7543. DOI 10.1038/s41467-023-42754-w · PubMed
Other PDB entries of the same protein (UniProt P20809 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 8DPW directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.