8EQ5: N-terminal kinase domain of RSK2

Crystal structure of the N-terminal kinase domain of RSK2 in complex with SPRED2 (131-160). Determined by X-ray diffraction at 1.8 Å resolution. Released 26 Apr 2023.

Method: X-ray diffraction
Resolution: 1.8 Å
Organism: Homo sapiens
Chains: 2
Atoms: 2,514
Mol. weight: 38.76 kDa
Ligands: QCT
Released: 26 Apr 2023

Explore 8EQ5 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8EQ5 contains 18 α-helices and 16 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 18 helices, 14 β-strands

Element	Residues	Length	Sheet
β-strand	50-56	7	1
α-helix	57	1
α-helix	65-67	3
β-strand	68-75	8	2
α-helix	77-79	3
β-strand	81-87	7	2
β-strand	96-102	7	2
β-strand	105-111	7	1
β-strand	130-131	2	3
β-strand	133-139	7	2
β-strand	142-147	6	2
β-strand	154-155	2	3
α-helix	156-162	7
α-helix	167-187	21
α-helix	196-198	3
β-strand	199-201	3	3
β-strand	207-210	4	3
β-strand	213-216	4	1
α-helix	224-225	2
α-helix	232-234	3
α-helix	237-240	4
α-helix	248-263	16
α-helix	273-282	10
α-helix	283-284	2
β-strand	285	1	4
α-helix	286-288	3
α-helix	293-302	10
β-strand	304	1	5
α-helix	307-309	3
α-helix	318-322	5
α-helix	325-327	3
α-helix	332-336	5

Chain B: 0 helices, 2 β-strands

Element	Residues	Length	Sheet
β-strand	143	1	5
β-strand	145	1	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Ribosomal protein S6 kinase alpha-3	A	protein	305	Homo sapiens	P51812 (AlphaFold model)
Sprouty-related, EVH1 domain-containing protein 2	B	protein	30	Homo sapiens	Q7Z698 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>8EQ5_1 Ribosomal protein S6 kinase alpha-3 (chains A)
GAMGSIKEIAITHHVKEGHEKADPSQFELLKVLGQGSFGKVFLVKKISGSDARQLYAMKV
LKKATLKVRDRVRTKMERDILVEVNHPFIVKLHYAFQTEGKLYLILDFLRGGDLFTRLSK
EVMFTEEDVKFYLAELALALDHLHSLGIIYRDLKPENILLDEEGHIKLTDFGLSKESIDH
EKKAYSFCGTVEYMAPEVVNRRGHTQSADWWSFGVLMFEMLTGTLPFQGKDRKETMTMIL
KAKLGMPQFLSPEAQSLLRMLFKRNPANRLGAGPDGVEEIKRHSFFSTIDWNKLYRREIH
PPFKP

Sequence of entity 2 (B), FASTA

>8EQ5_2 Sprouty-related, EVH1 domain-containing protein 2 (chains B)
STIHNEAELGDDDVFTTATDSSSNSSQKRE

Ligands and cofactors

ID	Name	Formula	Copies
QCT	2-(3,4-dihydroxyphenyl)-5,7-dihydroxy-4-oxo-4H-chromen-3-yl…	C21 H20 O11	1

Primary citation

The ribosomal S6 kinase 2 (RSK2)-SPRED2 complex regulates the phosphorylation of RSK substrates and MAPK signaling. Lopez, J., Bonsor, D.A., Sale, M.J. et al. J Biol Chem (2023) 299:104789-104789. DOI 10.1016/j.jbc.2023.104789 · PubMed

Other PDB entries of the same protein (UniProt P51812 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4NW6 1.74 Å, Rsk2 N-terminal kinase in complex with 2-amino-7-substituted benzoxazole compound 27
4NW5 1.94 Å, Rsk2 N-terminal kinase in complex with 2-amino-7-substituted benzoxazole compound 8
5D9L 2.15 Å, Rsk2 N-terminal Kinase in Complex with bis-phenol pyrazole
8R58 2.31 Å, The RSK 2 N-terminal kinase domain in complex with BMF (1-19)
4NUS 2.39 Å, Rsk2 N-terminal kinase in complex with LJH685
4D9T 2.4 Å, Rsk2 C-terminal Kinase Domain with inhibitor (E)-methyl…
4D9U 2.4 Å, Rsk2 C-terminal Kinase Domain, (E)-tert-butyl 3-(4-amino-7-(3-hydroxypropyl)-5-p-tolyl-7H…
5D9K 2.55 Å, Rsk2 N-terminal Kinase in Complex with BI-D1870
4JG6 2.6 Å, RSK2 CTD bound to 2-cyano-3-(1H-indazol-5-yl)acrylamide
8XEY 2.65 Å, The Crystal Structure of C-terminal kinase domain of RSK2 from Biortus
7OPO 2.75 Å, RSK2 N-terminal kinase domain in complex with ORF45
4JG7 3.0 Å, Structure of RSK2 CTD bound to 3-(3-(1H-pyrrolo[2,3-b]pyridine-3-carbonyl)phenyl)-2-cyano…

Browse structure collections

About this viewer

MolViewer shows 8EQ5 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.