8EYX: Insulin receptor

Cryo-EM structure of 4 insulins bound full-length mouse IR mutant with physically decoupled alpha CTs (C684S/C685S/C687S; denoted as IR-3CS) Asymmetric conformation 1. Determined by electron microscopy at 4.5 Å resolution. Released 9 Nov 2022.

Method: Electron microscopy
Resolution: 4.5 Å
Organisms: Mus musculus, Homo sapiens
Chains: 6
Atoms: 14,298
Mol. weight: 354.33 kDa
Released: 9 Nov 2022

Explore 8EYX in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8EYX contains 55 α-helices and 144 β-strands across 6 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 22 helices, 75 β-strands

Element	Residues	Length	Sheet
β-strand	6	1	1
β-strand	12-13	2	2
α-helix	19-23	5
β-strand	26	1	1
β-strand	29	1	3
β-strand	33-38	6	2
α-helix	44-47	4
β-strand	56-57	2	3
β-strand	61-66	6	2
β-strand	81-82	2	3
β-strand	88	1	4
β-strand	91	1	4
β-strand	93-96	4	2
β-strand	111-112	2	3
β-strand	117-122	6	2
α-helix	140-142	3
β-strand	144-148	5	2
α-helix	149-152	4
β-strand	171-173	3	5
β-strand	178-180	3	5
β-strand	182-184	3	6
β-strand	187-188	2	6
β-strand	201	1	7
β-strand	207	1	7
β-strand	213	1	8
β-strand	215	1	8
β-strand	216	1	9
β-strand	225	1	9
β-strand	231-232	2	10
β-strand	237-238	2	10
β-strand	246-248	3	10
β-strand	252-254	3	10
α-helix	256-267	12
β-strand	278-280	3	10
β-strand	283-285	3	10
β-strand	292-294	3	11
β-strand	300	1	10
β-strand	301-303	3	11
α-helix	304	1
β-strand	311-312	2	12
α-helix	313-314	2
β-strand	318-321	4	13
α-helix	324-328	5
β-strand	335-336	2	12
β-strand	339-342	4	13
α-helix	351-357	7
β-strand	363-364	2	12
β-strand	368-371	4	13
β-strand	378	1	14
α-helix	379-381	3
β-strand	387-388	2	12
α-helix	393	1
β-strand	394	1	15
β-strand	398	1	15
β-strand	400-403	4	13
β-strand	410	1	14
β-strand	420-421	2	12
β-strand	426-429	4	13
α-helix	436-446	11
α-helix	449-451	3
β-strand	457	1	13
β-strand	472-473	2	16
β-strand	475-480	6	17
β-strand	485-489	5	17
α-helix	490-492	3
α-helix	497-499	3
β-strand	500-509	10	16
β-strand	530-534	5	16
α-helix	535-537	3
β-strand	553-555	3	17
β-strand	563-572	10	16
β-strand	584-585	2	16
α-helix	586-587	2
β-strand	588-591	4	16
β-strand	601-609	9	18
β-strand	612-618	7	18
β-strand	629-636	8	19
α-helix	638-640	3
α-helix	641-643	3
α-helix	706-715	10
β-strand	761-764	4	19
β-strand	769-772	4	18
β-strand	780-788	9	19
β-strand	797	1	19
β-strand	801-806	6	19
β-strand	820-824	5	20
β-strand	830-834	5	20
β-strand	844-853	10	21
β-strand	859-864	6	21
α-helix	865-871	7
β-strand	874-876	3	20
β-strand	882-883	2	22
β-strand	884-892	9	21
β-strand	896	1	21
α-helix	898-902	5
β-strand	903	1	21
β-strand	906-907	2	22

Chain B: 17 helices, 67 β-strands

Element	Residues	Length	Sheet
β-strand	6	1	23
β-strand	9	1	24
β-strand	12-13	2	25
α-helix	19-23	5
β-strand	26	1	23
β-strand	28-29	2	26
β-strand	30	1	24
β-strand	32-38	7	25
α-helix	43-45	3
β-strand	56-57	2	26
β-strand	60-66	7	25
β-strand	81-82	2	27
β-strand	93-96	4	25
β-strand	111-112	2	27
β-strand	117-122	6	25
α-helix	133-135	3
β-strand	137	1	27
β-strand	144-148	5	25
β-strand	216	1	28
β-strand	225	1	28
β-strand	231-232	2	29
β-strand	237-238	2	29
β-strand	246-248	3	29
β-strand	252-254	3	29
α-helix	256-269	14
β-strand	278-280	3	30
β-strand	283-285	3	30
α-helix	288-289	2
β-strand	292-293	2	31
β-strand	300	1	30
β-strand	302-303	2	31
β-strand	311-312	2	32
α-helix	315-317	3
β-strand	318-321	4	33
α-helix	324-328	5
β-strand	335-336	2	32
β-strand	339-342	4	33
α-helix	353-358	6
β-strand	363-364	2	32
β-strand	368-371	4	33
β-strand	387-388	2	32
β-strand	394	1	33
β-strand	398-403	6	33
β-strand	420-421	2	32
β-strand	425-426	2	33
β-strand	428	1	34
β-strand	429	1	33
β-strand	431	1	35
α-helix	436-446	11
β-strand	457	1	34
β-strand	462	1	35
β-strand	471-473	3	36
β-strand	477-480	4	37
β-strand	485-488	4	37
β-strand	502-509	8	36
β-strand	530-534	5	36
β-strand	552-555	4	37
α-helix	558-559	2
β-strand	563-571	9	36
β-strand	583-585	3	36
β-strand	588-591	4	36
α-helix	592-594	3
α-helix	599-600	2
β-strand	601-609	9	38
β-strand	612-618	7	38
β-strand	629-636	8	39
α-helix	638-640	3
α-helix	641-644	4
α-helix	691-715	25
β-strand	761-764	4	39
β-strand	769-772	4	38
β-strand	780-790	11	39
β-strand	796-797	2	39
β-strand	801-806	6	39
β-strand	821-824	4	40
β-strand	830-833	4	40
β-strand	844-853	10	41
β-strand	859-864	6	41
α-helix	865-871	7
β-strand	874-876	3	40
β-strand	882-892	11	41
β-strand	896	1	41
α-helix	898-902	5
β-strand	903-907	5	41

Chain D: 4 helices, 0 β-strands

Element	Residues	Length
α-helix	9-18	10
α-helix	57	1
α-helix	58-63	6
α-helix	68-72	5

Chain E: 3 helices, 0 β-strands

Element	Residues	Length
α-helix	8-18	11
α-helix	58-61	4
α-helix	68-72	5

Chain F: 5 helices, 0 β-strands

Element	Residues	Length
α-helix	9-18	10
α-helix	58	1
α-helix	59-63	5
α-helix	68-70	3
α-helix	72-74	3

Chain G: 4 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	9-18	10
β-strand	24	1	42
α-helix	58-63	6
α-helix	68-70	3
α-helix	72-74	3
β-strand	75	1	42

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Insulin receptor	A, B	protein	1345	Mus musculus	P15208 (AlphaFold model)
Insulin	D, E, F, G	protein	110	Homo sapiens	P01308 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>8EYX_1 Insulin receptor (chains A, B)
HLYPGEVCPGMDIRNNLTRLHELENCSVIEGHLQILLMFKTRPEDFRDLSFPKLIMITDY
LLLFRVYGLESLKDLFPNLTVIRGSRLFFNYALVIFEMVHLKELGLYNLMNITRGSVRIE
KNNELCYLATIDWSRILDSVEDNYIVLNKDDNEECGDVCPGTAKGKTNCPATVINGQFVE
RCWTHSHCQKVCPTICKSHGCTAEGLCCHKECLGNCSEPDDPTKCVACRNFYLDGQCVET
CPPPYYHFQDWRCVNFSFCQDLHFKCRNSRKPGCHQYVIHNNKCIPECPSGYTMNSSNLM
CTPCLGPCPKVCQILEGEKTIDSVTSAQELRGCTVINGSLIINIRGGNNLAAELEANLGL
IEEISGFLKIRRSYALVSLSFFRKLHLIRGETLEIGNYSFYALDNQNLRQLWDWSKHNLT
ITQGKLFFHYNPKLCLSEIHKMEEVSGTKGRQERNDIALKTNGDQASCENELLKFSFIRT
SFDKILLRWEPYWPPDFRDLLGFMLFYKEAPYQNVTEFDGQDACGSNSWTVVDIDPPQRS
NDPKSQTPSHPGWLMRGLKPWTQYAIFVKTLVTFSDERRTYGAKSDIIYVQTDATNPSVP
LDPISVSNSSSQIILKWKPPSDPNGNITHYLVYWERQAEDSELFELDYCLKGLKLPSRTW
SPPFESDDSQKHNQSEYDDSASESSSSPKTDSQILKELEESSFRKTFEDYLHNVVFVPRP
SRKRRSLEEVGNVTATTLTLPDFPNVSSTIVPTSQEEHRPFEKVVNKESLVISGLRHFTG
YRIELQACNQDSPDERCSVAAYVSARTMPEAKADDIVGPVTHEIFENNVVHLMWQEPKEP
NGLIVLYEVSYRRYGDEELHLCVSRKHFALERGCRLRGLSPGNYSVRVRATSLAGNGSWT
EPTYFYVTDYLDVPSNIAKIIIGPLIFVFLFSVVIGSIYLFLRKRQPDGPMGPLYASSNP
EYLSASDVFPSSVYVPDEWEVPREKITLLRELGQGSFGMVYEGNAKDIIKGEAETRVAVK
TVNESASLRERIEFLNEASVMKGFTCHHVVRLLGVVSKGQPTLVVMELMAHGDLKSHLRS
LRPDAENNPGRPPPTLQEMIQMTAEIADGMAYLNAKKFVHRDLAARNCMVAHDFTVKIGD
FGMTRDIYETDYYRKGGKGLLPVRWMSPESLKDGVFTASSDMWSFGVVLWEITSLAEQPY
QGLSNEQVLKFVMDGGYLDPPDNCPERLTDLMRMCWQFNPKMRPTFLEIVNLLKDDLHPS
FPEVSFFYSEENKAPESEELEMEFEDMENVPLDRSSHCQREEAGGREGGSSLSIKRTYDE
HIPYTHMNGGKKNGRVLTLPRSNPS

Sequence of entity 2 (D, E, F, G), FASTA

>8EYX_2 Insulin (chains D, E, F, G)
MALWMRLLPLLALLALWGPDPAAAFVNQHLCGSHLVEALYLVCGERGFFYTPKTRREAED
LQVGQVELGGGPGAGSLQPLALEGSLQKRGIVEQCCTSICSLYQLENYCN

Primary citation

Molecular basis for the role of disulfide-linked alpha CTs in the activation of insulin-like growth factor 1 receptor and insulin receptor. Li, J., Wu, J., Hall, C. et al. Elife (2022) 11. DOI 10.7554/eLife.81286 · PubMed

Other PDB entries of the same protein (UniProt P15208 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1LK2 1.35 Å, 1.35A crystal structure of H-2Kb complexed with the GNYSFYAL peptide
7SL7 3.1 Å, Full-length insulin receptor bound with both site 1 binding deficient mutant insulin…
7SL1 3.4 Å, Full-length insulin receptor bound with site 1 binding deficient mutant insulin (A-V3E)
7SL3 3.4 Å, Full-length insulin receptor bound with site 2 binding deficient mutant insulin (A-L13R)…
7STH 3.5 Å, Full-length insulin receptor bound with unsaturated insulin WT (2 insulin bound)…
8DTM 3.5 Å, Cryo-EM structure of insulin receptor (IR) bound with S597 component 2
7SL2 3.6 Å, Full-length insulin receptor bound with site 2 binding deficient mutant insulin (A-L13R)…
7SL6 3.7 Å, Full-length insulin receptor bound with site 2 binding deficient mutant insulin (B-L17R)…
8EZ0 3.7 Å, Cryo-EM structure of 4 insulins bound full-length mouse IR mutant with physically…
7STK 4.0 Å, Full-length insulin receptor bound with unsaturated insulin WT (2 insulins bound)…
7STJ 4.4 Å, Full-length insulin receptor bound with unsaturated insulin WT (2 insulins bound)…
7STI 4.9 Å, Full-length insulin receptor bound with unsaturated insulin WT (1 insulin bound)…

Browse structure collections

About this viewer

MolViewer shows 8EYX directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.