8EYY: Insulin receptor
Cryo-EM structure of 4 insulins bound full-length mouse IR mutant with physically decoupled alpha CTs (C684S/C685S/C687S, denoted as IR-3CS) Asymmetric conformation 2. Determined by electron microscopy at 4.9 Å resolution. Released 9 Nov 2022.
- Method
- Electron microscopy
- Resolution
- 4.9 Å
- Organisms
- Mus musculus, Homo sapiens
- Chains
- 6
- Atoms
- 14,301
- Mol. weight
- 354.33 kDa
- Released
- 9 Nov 2022
Explore 8EYY in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
8EYY contains 61 α-helices and 149 β-strands across 6 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chain A: 22 helices, 70 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 9-14 | 6 | 1 |
| α-helix | 19-23 | 5 | |
| β-strand | 28-29 | 2 | 2 |
| β-strand | 30-38 | 9 | 1 |
| α-helix | 44-47 | 4 | |
| β-strand | 56-57 | 2 | 2 |
| β-strand | 61-66 | 6 | 1 |
| β-strand | 81-82 | 2 | 2 |
| β-strand | 88 | 1 | 1 |
| β-strand | 91-98 | 8 | 1 |
| β-strand | 111-112 | 2 | 2 |
| β-strand | 116-120 | 5 | 1 |
| β-strand | 122 | 1 | 3 |
| α-helix | 133-136 | 4 | |
| β-strand | 137 | 1 | 2 |
| β-strand | 144-145 | 2 | 1 |
| β-strand | 148 | 1 | 3 |
| β-strand | 212 | 1 | 4 |
| β-strand | 213 | 1 | 5 |
| β-strand | 215 | 1 | 5 |
| β-strand | 216 | 1 | 6 |
| β-strand | 225 | 1 | 6 |
| β-strand | 228 | 1 | 4 |
| β-strand | 231-233 | 3 | 7 |
| β-strand | 236-238 | 3 | 7 |
| β-strand | 246-248 | 3 | 7 |
| β-strand | 252-254 | 3 | 7 |
| α-helix | 256-265 | 10 | |
| β-strand | 278-280 | 3 | 8 |
| β-strand | 283-285 | 3 | 8 |
| β-strand | 292-295 | 4 | 8 |
| β-strand | 300-303 | 4 | 8 |
| α-helix | 308-309 | 2 | |
| β-strand | 311-312 | 2 | 9 |
| α-helix | 315-317 | 3 | |
| β-strand | 318-321 | 4 | 10 |
| α-helix | 324-329 | 6 | |
| β-strand | 335-336 | 2 | 9 |
| β-strand | 339-342 | 4 | 10 |
| α-helix | 353-358 | 6 | |
| β-strand | 363-364 | 2 | 9 |
| β-strand | 368-371 | 4 | 10 |
| β-strand | 378 | 1 | 11 |
| β-strand | 387-388 | 2 | 9 |
| β-strand | 394 | 1 | 10 |
| β-strand | 398-403 | 6 | 10 |
| β-strand | 410 | 1 | 11 |
| β-strand | 420-421 | 2 | 9 |
| β-strand | 425-426 | 2 | 10 |
| β-strand | 428 | 1 | 12 |
| β-strand | 429 | 1 | 10 |
| β-strand | 431 | 1 | 13 |
| α-helix | 436-445 | 10 | |
| β-strand | 457 | 1 | 12 |
| β-strand | 462 | 1 | 13 |
| β-strand | 471-472 | 2 | 14 |
| β-strand | 475-479 | 5 | 15 |
| β-strand | 486-489 | 4 | 15 |
| α-helix | 490-492 | 3 | |
| α-helix | 497-499 | 3 | |
| β-strand | 500-509 | 10 | 14 |
| α-helix | 535-537 | 3 | |
| β-strand | 552-554 | 3 | 15 |
| α-helix | 558-559 | 2 | |
| β-strand | 563-572 | 10 | 14 |
| β-strand | 583-584 | 2 | 14 |
| β-strand | 588-591 | 4 | 14 |
| α-helix | 592-594 | 3 | |
| α-helix | 599-600 | 2 | |
| β-strand | 601-607 | 7 | 16 |
| β-strand | 613-618 | 6 | 16 |
| β-strand | 629-636 | 8 | 17 |
| α-helix | 638-640 | 3 | |
| α-helix | 642-644 | 3 | |
| α-helix | 691-715 | 25 | |
| β-strand | 761-764 | 4 | 17 |
| β-strand | 769-772 | 4 | 16 |
| β-strand | 780-790 | 11 | 17 |
| β-strand | 796-797 | 2 | 17 |
| β-strand | 801-806 | 6 | 17 |
| α-helix | 807-809 | 3 | |
| α-helix | 816 | 1 | |
| β-strand | 817-824 | 8 | 18 |
| β-strand | 830-835 | 6 | 18 |
| β-strand | 844-853 | 10 | 19 |
| β-strand | 859-864 | 6 | 19 |
| α-helix | 865-871 | 7 | |
| β-strand | 874-876 | 3 | 18 |
| β-strand | 882-892 | 11 | 19 |
| β-strand | 896-899 | 4 | 19 |
| α-helix | 900-901 | 2 | |
| β-strand | 903-907 | 5 | 19 |
Chain B: 23 helices, 73 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 6 | 1 | 20 |
| β-strand | 9 | 1 | 21 |
| β-strand | 12-14 | 3 | 22 |
| α-helix | 19-23 | 5 | |
| β-strand | 26 | 1 | 20 |
| β-strand | 28-29 | 2 | 23 |
| β-strand | 30 | 1 | 21 |
| β-strand | 33-38 | 6 | 22 |
| α-helix | 43-47 | 5 | |
| β-strand | 56-57 | 2 | 23 |
| β-strand | 61-66 | 6 | 22 |
| β-strand | 81-82 | 2 | 23 |
| β-strand | 93-98 | 6 | 22 |
| β-strand | 111-112 | 2 | 23 |
| β-strand | 117-122 | 6 | 22 |
| α-helix | 133-136 | 4 | |
| β-strand | 137 | 1 | 23 |
| β-strand | 144-148 | 5 | 22 |
| α-helix | 149-152 | 4 | |
| β-strand | 171-173 | 3 | 24 |
| β-strand | 178-180 | 3 | 24 |
| β-strand | 182-184 | 3 | 25 |
| β-strand | 187-188 | 2 | 25 |
| β-strand | 201 | 1 | 26 |
| β-strand | 207 | 1 | 26 |
| β-strand | 213 | 1 | 27 |
| β-strand | 215 | 1 | 27 |
| β-strand | 216 | 1 | 28 |
| α-helix | 222-224 | 3 | |
| β-strand | 225 | 1 | 28 |
| β-strand | 231-233 | 3 | 29 |
| β-strand | 236-238 | 3 | 29 |
| β-strand | 245-248 | 4 | 29 |
| β-strand | 252-255 | 4 | 29 |
| α-helix | 256-267 | 12 | |
| β-strand | 278-280 | 3 | 29 |
| β-strand | 283-285 | 3 | 29 |
| β-strand | 292-294 | 3 | 30 |
| β-strand | 300 | 1 | 29 |
| β-strand | 301-303 | 3 | 30 |
| α-helix | 304 | 1 | |
| β-strand | 311-312 | 2 | 31 |
| α-helix | 313-314 | 2 | |
| α-helix | 315-317 | 3 | |
| β-strand | 318-321 | 4 | 32 |
| α-helix | 324-328 | 5 | |
| β-strand | 335-336 | 2 | 31 |
| β-strand | 339-342 | 4 | 32 |
| α-helix | 351-357 | 7 | |
| β-strand | 363-364 | 2 | 31 |
| β-strand | 368-370 | 3 | 32 |
| β-strand | 378 | 1 | 33 |
| β-strand | 387-388 | 2 | 31 |
| β-strand | 394 | 1 | 32 |
| β-strand | 398-403 | 6 | 32 |
| β-strand | 410 | 1 | 33 |
| β-strand | 420-421 | 2 | 31 |
| β-strand | 425-429 | 5 | 32 |
| α-helix | 436-446 | 11 | |
| α-helix | 449-451 | 3 | |
| β-strand | 457 | 1 | 32 |
| β-strand | 472-473 | 2 | 34 |
| β-strand | 475-480 | 6 | 35 |
| β-strand | 485-489 | 5 | 35 |
| α-helix | 497-499 | 3 | |
| β-strand | 500-509 | 10 | 34 |
| β-strand | 530-534 | 5 | 34 |
| α-helix | 535-539 | 5 | |
| β-strand | 553-555 | 3 | 35 |
| β-strand | 563-572 | 10 | 34 |
| β-strand | 584-585 | 2 | 34 |
| β-strand | 588-591 | 4 | 34 |
| α-helix | 599-600 | 2 | |
| β-strand | 601-607 | 7 | 36 |
| β-strand | 613-618 | 6 | 36 |
| β-strand | 629-637 | 9 | 37 |
| α-helix | 638-640 | 3 | |
| α-helix | 641-644 | 4 | |
| α-helix | 706-715 | 10 | |
| β-strand | 761-764 | 4 | 37 |
| β-strand | 769-772 | 4 | 36 |
| β-strand | 780-788 | 9 | 37 |
| β-strand | 797 | 1 | 37 |
| β-strand | 801-806 | 6 | 37 |
| α-helix | 807-810 | 4 | |
| α-helix | 812-814 | 3 | |
| β-strand | 817-824 | 8 | 38 |
| β-strand | 830-835 | 6 | 38 |
| β-strand | 844-853 | 10 | 39 |
| β-strand | 859-864 | 6 | 39 |
| α-helix | 865-871 | 7 | |
| β-strand | 874-876 | 3 | 38 |
| β-strand | 882-892 | 11 | 39 |
| β-strand | 896 | 1 | 39 |
| α-helix | 898-902 | 5 | |
| β-strand | 903-907 | 5 | 39 |
Chain C: 4 helices, 2 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 9-18 | 10 | |
| β-strand | 24 | 1 | 40 |
| α-helix | 58 | 1 | |
| α-helix | 59-63 | 5 | |
| α-helix | 72-74 | 3 | |
| β-strand | 75 | 1 | 40 |
Chain D: 5 helices, 2 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 8-18 | 11 | |
| β-strand | 24 | 1 | 41 |
| α-helix | 58-62 | 5 | |
| α-helix | 65-67 | 3 | |
| α-helix | 68-71 | 4 | |
| α-helix | 72-74 | 3 | |
| β-strand | 75 | 1 | 41 |
Chain E: 4 helices, 2 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 8-18 | 11 | |
| β-strand | 24 | 1 | 42 |
| α-helix | 57-58 | 2 | |
| α-helix | 59-63 | 5 | |
| α-helix | 68-72 | 5 | |
| β-strand | 75 | 1 | 42 |
Chain F: 3 helices, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 9-18 | 10 | |
| α-helix | 58-62 | 5 | |
| α-helix | 72-74 | 3 | |
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| Insulin receptor | A, B | protein | 1345 | Mus musculus | P15208 (AlphaFold model) |
| Insulin | C, D, E, F | protein | 110 | Homo sapiens | P01308 (AlphaFold model) |
Sequence of entity 1 (A, B), FASTA
>8EYY_1 Insulin receptor (chains A, B)
HLYPGEVCPGMDIRNNLTRLHELENCSVIEGHLQILLMFKTRPEDFRDLSFPKLIMITDY
LLLFRVYGLESLKDLFPNLTVIRGSRLFFNYALVIFEMVHLKELGLYNLMNITRGSVRIE
KNNELCYLATIDWSRILDSVEDNYIVLNKDDNEECGDVCPGTAKGKTNCPATVINGQFVE
RCWTHSHCQKVCPTICKSHGCTAEGLCCHKECLGNCSEPDDPTKCVACRNFYLDGQCVET
CPPPYYHFQDWRCVNFSFCQDLHFKCRNSRKPGCHQYVIHNNKCIPECPSGYTMNSSNLM
CTPCLGPCPKVCQILEGEKTIDSVTSAQELRGCTVINGSLIINIRGGNNLAAELEANLGL
IEEISGFLKIRRSYALVSLSFFRKLHLIRGETLEIGNYSFYALDNQNLRQLWDWSKHNLT
ITQGKLFFHYNPKLCLSEIHKMEEVSGTKGRQERNDIALKTNGDQASCENELLKFSFIRT
SFDKILLRWEPYWPPDFRDLLGFMLFYKEAPYQNVTEFDGQDACGSNSWTVVDIDPPQRS
NDPKSQTPSHPGWLMRGLKPWTQYAIFVKTLVTFSDERRTYGAKSDIIYVQTDATNPSVP
LDPISVSNSSSQIILKWKPPSDPNGNITHYLVYWERQAEDSELFELDYCLKGLKLPSRTW
SPPFESDDSQKHNQSEYDDSASESSSSPKTDSQILKELEESSFRKTFEDYLHNVVFVPRP
SRKRRSLEEVGNVTATTLTLPDFPNVSSTIVPTSQEEHRPFEKVVNKESLVISGLRHFTG
YRIELQACNQDSPDERCSVAAYVSARTMPEAKADDIVGPVTHEIFENNVVHLMWQEPKEP
NGLIVLYEVSYRRYGDEELHLCVSRKHFALERGCRLRGLSPGNYSVRVRATSLAGNGSWT
EPTYFYVTDYLDVPSNIAKIIIGPLIFVFLFSVVIGSIYLFLRKRQPDGPMGPLYASSNP
EYLSASDVFPSSVYVPDEWEVPREKITLLRELGQGSFGMVYEGNAKDIIKGEAETRVAVK
TVNESASLRERIEFLNEASVMKGFTCHHVVRLLGVVSKGQPTLVVMELMAHGDLKSHLRS
LRPDAENNPGRPPPTLQEMIQMTAEIADGMAYLNAKKFVHRDLAARNCMVAHDFTVKIGD
FGMTRDIYETDYYRKGGKGLLPVRWMSPESLKDGVFTASSDMWSFGVVLWEITSLAEQPY
QGLSNEQVLKFVMDGGYLDPPDNCPERLTDLMRMCWQFNPKMRPTFLEIVNLLKDDLHPS
FPEVSFFYSEENKAPESEELEMEFEDMENVPLDRSSHCQREEAGGREGGSSLSIKRTYDE
HIPYTHMNGGKKNGRVLTLPRSNPS
Sequence of entity 2 (C, D, E, F), FASTA
>8EYY_2 Insulin (chains C, D, E, F)
MALWMRLLPLLALLALWGPDPAAAFVNQHLCGSHLVEALYLVCGERGFFYTPKTRREAED
LQVGQVELGGGPGAGSLQPLALEGSLQKRGIVEQCCTSICSLYQLENYCN
Primary citation
Molecular basis for the role of disulfide-linked alpha CTs in the activation of insulin-like growth factor 1 receptor and insulin receptor. Li, J., Wu, J., Hall, C. et al. Elife (2022) 11. DOI 10.7554/eLife.81286 · PubMed
Other PDB entries of the same protein (UniProt P15208 (AlphaFold model), which also has an AlphaFold model), best resolution first:
- 1LK2 1.35 Å, 1.35A crystal structure of H-2Kb complexed with the GNYSFYAL peptide
- 7SL7 3.1 Å, Full-length insulin receptor bound with both site 1 binding deficient mutant insulin…
- 7SL1 3.4 Å, Full-length insulin receptor bound with site 1 binding deficient mutant insulin (A-V3E)
- 7SL3 3.4 Å, Full-length insulin receptor bound with site 2 binding deficient mutant insulin (A-L13R)…
- 7STH 3.5 Å, Full-length insulin receptor bound with unsaturated insulin WT (2 insulin bound)…
- 8DTM 3.5 Å, Cryo-EM structure of insulin receptor (IR) bound with S597 component 2
- 7SL2 3.6 Å, Full-length insulin receptor bound with site 2 binding deficient mutant insulin (A-L13R)…
- 7SL6 3.7 Å, Full-length insulin receptor bound with site 2 binding deficient mutant insulin (B-L17R)…
- 8EZ0 3.7 Å, Cryo-EM structure of 4 insulins bound full-length mouse IR mutant with physically…
- 7STK 4.0 Å, Full-length insulin receptor bound with unsaturated insulin WT (2 insulins bound)…
- 7STJ 4.4 Å, Full-length insulin receptor bound with unsaturated insulin WT (2 insulins bound)…
- 8EYX 4.5 Å, Cryo-EM structure of 4 insulins bound full-length mouse IR mutant with physically…
Browse structure collections
About this viewer
MolViewer shows 8EYY directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.