Crystal structure of PPARgamma ligand-binding domain in complex with N-CoR peptide and inverse agonist SR33544. Determined by X-ray diffraction at 1.42 Å resolution. Released 17 Apr 2024.
Explore 8FKC in 3D Show helices and sheets RCSB PDB PDBe
8FKC contains 16 α-helices and 4 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 206-225 | 20 | |
| α-helix | 230-237 | 8 | |
| α-helix | 246 | 1 | |
| β-strand | 247-249 | 3 | 1 |
| α-helix | 252-257 | 6 | |
| α-helix | 277-288 | 12 | |
| α-helix | 290-301 | 12 | |
| α-helix | 306-308 | 3 | |
| α-helix | 311-332 | 22 | |
| β-strand | 334-335 | 2 | 1 |
| β-strand | 338-341 | 4 | 1 |
| β-strand | 346-349 | 4 | 1 |
| α-helix | 350-355 | 6 | |
| α-helix | 360-362 | 3 | |
| α-helix | 365-375 | 11 | |
| α-helix | 381-392 | 12 | |
| α-helix | 403-424 | 22 | |
| α-helix | 431-458 | 28 | |
| α-helix | 467-474 | 8 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 2261-2271 | 11 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Peroxisome proliferator-activated receptor gamma | A | protein | 276 | Homo sapiens | P37231 (AlphaFold model) |
| Nuclear receptor corepressor 1 | D | protein | 23 | Homo sapiens | O75376 (AlphaFold model) |
>8FKC_1 Peroxisome proliferator-activated receptor gamma (chains A) GQLNPESADLRALAKHLYDSYIKSFPLTKAKARAILTGKTTDKSPFVIYDMNSLMMGEDK IKFKHITPLQEQSKEVAIRIFQGCQFRSVEAVQEITEYAKSIPGFVNLDLNDQVTLLKYG VHEIIYTMLASLMNKDGVLISEGQGFMTREFLKSLRKPFGDFMEPKFEFAVKFNALELDD SDLAIFIAVIILSGDRPGLLNVKPIEDIQDNLLQALELQLKLNHPESSQLFAKLLQKMTD LRQIVTEHVQLLQVIKKTETDMSLHPLLQEIYKDLY
>8FKC_2 Nuclear receptor corepressor 1 (chains D) DPASNLGLEDIIRKALMGSFDDK
| ID | Name | Formula | Copies |
|---|---|---|---|
| Y5F | 2-chloro-N-(5-cyanopyridin-3-yl)-5-nitrobenzamide | C13 H7 Cl N4 O3 | 1 |
Water and common crystallization additives (EDO) are not listed.
Ligand efficacy shifts a nuclear receptor conformational ensemble between transcriptionally active and repressive states. MacTavish, B.S., Zhu, D., Shang, J. et al. Nat Commun (2025) 16:2065-2065. DOI 10.1038/s41467-025-57325-4 · PubMed
Other PDB entries of the same protein (UniProt P37231 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 8FKC directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.