The von Willebrand factor A domain of Anthrax toxin receptor 2. Determined by X-ray diffraction at 2.19 Å resolution. Released 1 Mar 2023.
Explore 8FZ4 in 3D Show helices and sheets RCSB PDB PDBe
8FZ4 contains 20 α-helices and 12 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 43-50 | 8 | 1 |
| α-helix | 53-58 | 6 | |
| α-helix | 59-72 | 14 | |
| β-strand | 78-85 | 8 | 1 |
| β-strand | 89-96 | 8 | 1 |
| α-helix | 99-110 | 12 | |
| α-helix | 120-134 | 15 | |
| α-helix | 136-138 | 3 | |
| β-strand | 141-147 | 7 | 1 |
| α-helix | 155-168 | 14 | |
| β-strand | 172-177 | 6 | 1 |
| α-helix | 183-189 | 7 | |
| α-helix | 193-195 | 3 | |
| β-strand | 196-198 | 3 | 1 |
| α-helix | 199-201 | 3 | |
| α-helix | 203-213 | 11 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Anthrax toxin receptor 2 | A, B | protein | 181 | Homo sapiens | P58335 (AlphaFold model) |
>8FZ4_1 Anthrax toxin receptor 2 (chains A, B) GSARRAFDLYFVLDKSGSVANNWIEIYNFVQQLAERFVSPEMRLSFIVFSSQATIILPLT GDRGKISKGLEDLKRVSPVGETYIHEGLKLANEQIQKAGGLKTSSIIIALTDGKLDGLVP SYAEKEAKISRSLGASVYAVGVLDFEQAQLERIADSKEQVFPVKGGFQALKGIINSILAQ S
| ID | Name | Formula | Copies |
|---|---|---|---|
| MG | Magnesium ion | Mg | 2 |
Water and common crystallization additives (CL) are not listed.
Increasing the bulk of the 1TEL-target linker and retaining the 10×His tag in a 1TEL-CMG2-vWa construct improves crystal order and diffraction limits. Gajjar, P.L., Pedroza Romo, M.J., Litchfield, C.M. et al. Acta Crystallogr D Struct Biol (2023) 79:925-943. DOI 10.1107/S2059798323007246 · PubMed
Other PDB entries of the same protein (UniProt P58335 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 8FZ4 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.