8GDH: Neutrophil Serine Protease Inhibitor, EapH1

Solution structure of the Neutrophil Serine Protease Inhibitor, EapH1. Determined by solution NMR. Released 26 Apr 2023.

Method: Solution NMR
Organism: Staphylococcus aureus
Chains: 1
Atoms: 893
Mol. weight: 12.72 kDa
Released: 26 Apr 2023

Explore 8GDH in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8GDH contains 4 α-helices and 8 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	18-26	9	1
β-strand	29-30	2	1
α-helix	31	1
β-strand	35-39	5	1
β-strand	45-46	2	2
α-helix	47-62	16
α-helix	66-71	6
β-strand	75-81	7	1
β-strand	86-90	5	1
β-strand	100-101	2	2
α-helix	103-105	3
β-strand	106-113	8	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Cell surface protein map-w	A	protein	114	Staphylococcus aureus	A0A0H3K0M1 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>8GDH_1 Cell surface protein map-w (chains A)
GSTDSNNGYKELTMDGKHTVPYTISVDGITALHRTYFVFPENKKVLYQEIDSKVKNELAS
QRGVTTEKINNAQTATYTLTLNDGNKKVVNLKKNDDAKNSIDPSTIKQIQIVVK

Primary citation

Simultaneous inhibition of two neutrophil serine proteases by the S. aureus innate immune evasion protein EapH2. Mishra, N., Herdendorf, T.J., Prakash, O. et al. J Biol Chem (2023) 299:104878-104878. DOI 10.1016/j.jbc.2023.104878 · PubMed

Other PDB entries of the same protein (UniProt A0A0H3K0M1 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6VTM 1.6 Å, Human Cathepsin-G Inhibited by S. aureus EapH1
1YN4 1.8 Å, Crystal Structures of EAP Domains from Staphylococcus aureus Reveal an Unexpected…
4NZL 1.85 Å, Extracellular proteins of Staphylococcus aureus inhibit the neutrophil serine proteases

Browse structure collections

About this viewer

MolViewer shows 8GDH directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.