8GRZ: V71C human neuroglobin mutant

X-ray crystal structure of V71C human neuroglobin mutant. Determined by X-ray diffraction at 2.0 Å resolution. Released 6 Sept 2023.

Method: X-ray diffraction
Resolution: 2.0 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,287
Mol. weight: 17.57 kDa
Ligands: HEM
Released: 6 Sept 2023

Explore 8GRZ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8GRZ contains 11 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 11 helices, 0 β-strands

Element	Residues	Length
α-helix	6-17	12
α-helix	20-34	15
α-helix	36-42	7
α-helix	43-46	4
α-helix	52-56	5
α-helix	59-77	19
α-helix	82-85	4
α-helix	86-98	13
α-helix	104-121	18
α-helix	122-124	3
α-helix	127-148	22

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Neuroglobin	A	protein	151	Homo sapiens	Q9NPG2 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>8GRZ_1 Neuroglobin (chains A)
MERPEPELIRQSWRAVSRSPLEHGTVLFARLFALEPDLLPLFQYNCRQFSSPEDCLSSPE
FLDHIRKVMLCIDAAVTNVEDLSSLEEYLASLGRKHRAVGVKLSSFSTVGESLLYMLEKC
LGPAFTPATRAAWSQLYGAVVQAMSRGWDGE

Ligands and cofactors

ID	Name	Formula	Copies
HEM	Protoporphyrin IX containing FE	C34 H32 Fe N4 O4	1

Primary citation

X-ray crystal structure of V71C human neuroglobin mutant. Lin, Y.W. To be published.

Other PDB entries of the same protein (UniProt Q9NPG2 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7VQG 1.35 Å, The X-ray structure of human neuroglobin A15C mutant
8WUB 1.5 Å, The X-ray structure of human neuroglobin C120S mutant
4MPM 1.74 Å, Wild-type human neuroglobin
1OJ6 1.95 Å, Human brain neuroglobin three-dimensional structure

Browse structure collections

About this viewer

MolViewer shows 8GRZ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.