8GTX: Human Spindlin1-HBx complex

Crystal Structure of human Spindlin1-HBx complex. Determined by X-ray diffraction at 1.8 Å resolution. Released 13 Sept 2023.

Method: X-ray diffraction
Resolution: 1.8 Å
Organisms: Homo sapiens, synthetic construct
Chains: 2
Atoms: 2,085
Mol. weight: 27.25 kDa
Released: 13 Sept 2023

Explore 8GTX in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8GTX contains 6 α-helices and 19 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 17 β-strands

Element	Residues	Length	Sheet
α-helix	49-51	3
β-strand	56-62	7	1
α-helix	68-69	2
β-strand	70-80	11	1
β-strand	83-91	9	1
β-strand	96	1	2
β-strand	98-100	3	1
β-strand	108-117	10	1
α-helix	118-120	3
α-helix	126-132	7
β-strand	136-142	7	2
β-strand	148-158	11	2
α-helix	159	1
β-strand	166-170	5	2
β-strand	175	1	3
β-strand	177-179	3	2
α-helix	181-186	6
β-strand	190-192	3	2
β-strand	217-221	5	3
β-strand	227-235	9	3
β-strand	242-247	6	3
β-strand	252	1	1
β-strand	254-260	7	3

Chain B: 0 helices, 2 β-strands

Element	Residues	Length	Sheet
β-strand	3-9	7	3
β-strand	14-18	5	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Spindlin-1	A	protein	218	Homo sapiens	Q9Y657 (AlphaFold model)
HBx	B	protein	20	synthetic construct	Q69607

Sequence of entity 1 (A), FASTA

>8GTX_1 Spindlin-1 (chains A)
GPLGSRRNIVGCRIQHGWKEGNGPVTQWKGTVLDQVPVNPSLYLIKYDGFDCVYGLELNK
DERVSALEVLPDRVATSRISDAHLADTMIGKAVEHMFETEDGSKDEWRGMVLARAPVMNT
WFYITYEKDPVLYMYQLLDDYKEGDLRIMPDSNDSPPAEREPGEVVDSLVGKQVEYAKED
GSKRTGMVIHQVEAKPSVYFIKFDDDFHIYVYDLVKTS

Sequence of entity 2 (B), FASTA

>8GTX_2 HBx (chains B)
AARMCCKLDPARDVLCLRPI

Primary citation

Crystal Structure of human Spindlin1-HBx complex. Liu, W., Li, H.T. To be published.

Other PDB entries of the same protein (UniProt Q9Y657 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7OCB 1.42 Å, Crystal structure of Spindlin1 in complex with the inhibitor XY49-92B
6I8Y 1.52 Å, Crystal structure of Spindlin1 in complex with the Methyltransferase inhibitor A366
6I8L 1.58 Å, Crystal structure of Spindlin1 in complex with the inhibitor TD001851a
6QPL 1.6 Å, Crystal structure of Spindlin1 in complex with the inhibitor MS31
7CNA 1.6 Å, Crystal structure of Spindlin1/C11orf84 complex bound to histone H3K4me3K9me3 peptide
4MZG 1.7 Å, Crystal structure of human Spindlin1 bound to histone H3K4me3 peptide
6I8B 1.76 Å, Crystal structure of Spindlin1 in complex with the inhibitor VinSpinIn
9T2Z 1.87 Å, Spindlin 1 with crystallization epitope mutations H127D:L128D:T131R
4H75 2.1 Å, Crystal structure of human Spindlin1 in complex with a histone H3K4(me3) peptide
4MZF 2.1 Å, Crystal structure of human Spindlin1 bound to histone H3(K4me3-R8me2a) peptide
2NS2 2.2 Å, Crystal Structure of Spindlin1
4MZH 2.2 Å, Crystal structure of human Spindlin1 bound to histone H3(K4me3-R8me2s) peptide

Browse structure collections

About this viewer

MolViewer shows 8GTX directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.