9T2Z: Spindlin-1

Spindlin 1 with crystallization epitope mutations H127D:L128D:T131R. Determined by X-ray diffraction at 1.87 Å resolution. Released 26 Nov 2025.

Method: X-ray diffraction
Resolution: 1.87 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,828
Mol. weight: 25.72 kDa
Released: 26 Nov 2025

Explore 9T2Z in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9T2Z contains 8 α-helices and 18 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 18 β-strands

Element	Residues	Length	Sheet
β-strand	10-15	6	1
β-strand	23-32	10	1
β-strand	40-44	5	1
β-strand	49	1	2
α-helix	50	1
β-strand	51-53	3	1
β-strand	61-66	6	1
α-helix	70-75	6
α-helix	79-85	7
β-strand	89-93	5	2
β-strand	103-111	9	2
α-helix	112	1
β-strand	119-123	5	2
β-strand	128	1	3
β-strand	130-132	3	2
α-helix	134-139	6
β-strand	143-145	3	2
α-helix	146-148	3
β-strand	170-174	5	3
α-helix	179	1
β-strand	180-188	9	3
β-strand	195-200	6	3
β-strand	205	1	1
β-strand	207-210	4	3
α-helix	214-216	3
β-strand	220-221	2	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Spindlin-1	A	protein	222	Homo sapiens	Q9Y657 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>9T2Z_1 Spindlin-1 (chains A)
MPRRNIVGCRIQHGWKEGNGPVTQWKGTVLDQVPVNPSLYLIKYDGFDCVYGLELNKDER
VSALEVLPDRVATSRISDADDADRMIGKAVEHMFETEDGSKDEWRGMVLARAPVMNTWFY
ITYEKDPVLYMYQLLDDYKEGDLRIMPDSNDSPPAEREPGEVVDSLVGKQVEYAKEDGSK
RTGMVIHQVEAKPSVYFIKFDDDFHIYVYDLVKTSAENLYFQ

Primary citation

A fast, parallel method for efficiently exploring crystallization behaviour of large numbers of protein variants. Fairhead, M., Strain-Damerell, C., Ye, M. et al. To be published.

Other PDB entries of the same protein (UniProt Q9Y657 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7OCB 1.42 Å, Crystal structure of Spindlin1 in complex with the inhibitor XY49-92B
6I8Y 1.52 Å, Crystal structure of Spindlin1 in complex with the Methyltransferase inhibitor A366
6I8L 1.58 Å, Crystal structure of Spindlin1 in complex with the inhibitor TD001851a
6QPL 1.6 Å, Crystal structure of Spindlin1 in complex with the inhibitor MS31
7CNA 1.6 Å, Crystal structure of Spindlin1/C11orf84 complex bound to histone H3K4me3K9me3 peptide
4MZG 1.7 Å, Crystal structure of human Spindlin1 bound to histone H3K4me3 peptide
6I8B 1.76 Å, Crystal structure of Spindlin1 in complex with the inhibitor VinSpinIn
8GTX 1.8 Å, Crystal Structure of human Spindlin1-HBx complex
4H75 2.1 Å, Crystal structure of human Spindlin1 in complex with a histone H3K4(me3) peptide
4MZF 2.1 Å, Crystal structure of human Spindlin1 bound to histone H3(K4me3-R8me2a) peptide
2NS2 2.2 Å, Crystal Structure of Spindlin1
4MZH 2.2 Å, Crystal structure of human Spindlin1 bound to histone H3(K4me3-R8me2s) peptide

Browse structure collections

About this viewer

MolViewer shows 9T2Z directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.