CENP-E motor domain in complex with AMPPNP and Mg2+. Determined by X-ray diffraction at 1.8 Å resolution. Released 8 Mar 2023.
Explore 8HFH in 3D Show helices and sheets RCSB PDB PDBe
8HFH contains 15 α-helices and 20 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 7-13 | 7 | 1 |
| α-helix | 14-16 | 3 | |
| α-helix | 18-21 | 4 | |
| β-strand | 31-33 | 3 | 2 |
| β-strand | 37-40 | 4 | 2 |
| β-strand | 46-48 | 3 | 2 |
| β-strand | 51-53 | 3 | 1 |
| α-helix | 59-62 | 4 | |
| α-helix | 63-67 | 5 | |
| α-helix | 68-75 | 8 | |
| β-strand | 80-85 | 6 | 1 |
| α-helix | 92-96 | 5 | |
| β-strand | 98-99 | 2 | 3 |
| β-strand | 102-103 | 2 | 3 |
| α-helix | 105-117 | 13 | |
| β-strand | 123-135 | 13 | 1 |
| β-strand | 138-141 | 4 | 1 |
| α-helix | 146-148 | 3 | |
| β-strand | 152 | 1 | 1 |
| β-strand | 154-156 | 3 | 4 |
| β-strand | 162-164 | 3 | 4 |
| β-strand | 170-172 | 3 | 1 |
| α-helix | 175-188 | 14 | |
| β-strand | 191-192 | 2 | 5 |
| β-strand | 200-201 | 2 | 5 |
| β-strand | 204-215 | 12 | 1 |
| β-strand | 226-235 | 10 | 1 |
| α-helix | 242-245 | 4 | |
| α-helix | 249-274 | 26 | |
| α-helix | 283-285 | 3 | |
| α-helix | 287-291 | 5 | |
| α-helix | 293-295 | 3 | |
| β-strand | 301-308 | 8 | 1 |
| α-helix | 314-326 | 13 | |
| β-strand | 337-338 | 2 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Centromere-associated protein E | A | protein | 353 | Homo sapiens | Q02224 (AlphaFold model) |
>8HFH_1 Centromere-associated protein E (chains A) MNHKVHMAEEGAVAVCVRVRPLNSREESLGETAQVYWKTDNNVIYQVDGSKSFNFDRVFH GNETTKNVYEEIAAPIIDSAIQGYNGTIFAYGQTASGKTYTMMGSEDHLGVIPRAIHDIF QKIKKFPDREFLLRVSYMEIYNETITDLLCGTQKMKPLIIREDVNRNVYVADLTEEVVYT SEMALKWITKGEKSRHYGETKMNQRSSRSHTIFRMILESREKGEPSNCEGSVKVSHLNLV DLAGSERAAQTGAAGVRLKEGCNINRSLFILGQVIKKLSDGQVGGFINYRDSKLTRILQN SLGGNPKTRIICTITPVSFDETLTALQFASTAKYMKNTPYVNEVSGSHHHHHH
| ID | Name | Formula | Copies |
|---|---|---|---|
| MG | Magnesium ion | Mg | 1 |
| ANP | Phosphoaminophosphonic acid-adenylate ester | C10 H17 N6 O12 P3 | 1 |
Water and common crystallization additives (IMD, NA) are not listed.
Crystal structure of the motor domain of centromere-associated protein E in complex with a non-hydrolysable ATP analogue. Shibuya, A., Suzuki, A., Ogo, N. et al. FEBS Lett (2023) 597:1138-1148. DOI 10.1002/1873-3468.14602 · PubMed
Other PDB entries of the same protein (UniProt Q02224 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 8HFH directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.