8HN1: AdTx1-alpha1AAR-Nb6

Cryo-EM structure of AdTx1-alpha1AAR-Nb6. Determined by electron microscopy at 2.9 Å resolution. Released 20 Dec 2023.

Method: Electron microscopy
Resolution: 2.9 Å
Organisms: Dendroaspis angusticeps, Homo sapiens, Lama glama
Chains: 3
Atoms: 3,560
Mol. weight: 61.3 kDa
Released: 20 Dec 2023

Explore 8HN1 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8HN1 contains 17 α-helices and 18 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 16 helices, 0 β-strands

Element	Residues	Length
α-helix	25-52	28
α-helix	60-74	15
α-helix	75-79	5
α-helix	80-89	10
α-helix	95-129	35
α-helix	134-137	4
α-helix	140-159	20
α-helix	161-164	4
α-helix	182-189	8
α-helix	190-194	5
α-helix	195-213	19
α-helix	221-297	37
α-helix	302-304	3
α-helix	305-316	12
α-helix	318-329	12
α-helix	332-342	11

Chain C: 1 helix, 7 β-strands

Element	Residues	Length	Sheet
β-strand	2-3	2	1
β-strand	7-8	2	2
β-strand	11-12	2	2
β-strand	15-16	2	1
β-strand	23-32	10	3
β-strand	35-43	9	3
α-helix	46-49	4
β-strand	58	1	3

Chain D: 0 helices, 11 β-strands

Element	Residues	Length	Sheet
β-strand	5-6	2	4
β-strand	21-25	5	5
β-strand	26-27	2	4
β-strand	32-39	8	6
β-strand	49	1	6
β-strand	51-54	4	6
β-strand	59-61	3	6
β-strand	70-74	5	5
β-strand	79-83	5	5
β-strand	96-102	7	6
β-strand	110-112	3	6

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Toxin AdTx1	C	protein	71	Dendroaspis angusticeps	P85092 (AlphaFold model)
Alpha-1A adrenergic receptor	A	protein	346	Homo sapiens	P35348 (AlphaFold model)
Nb6	D	protein	133	Lama glama

Sequence of entity 1 (C), FASTA

>8HN1_1 Toxin AdTx1 (chains C)
GPGSGSLTCVTSKSIFGITTEDCPDGQNLCFKRRHYVVPKIYDSTRGCAATCPIPENYDS
IHCCKTDKCNE

Sequence of entity 2 (A), FASTA

>8HN1_2 Alpha-1A adrenergic receptor (chains A)
DYKDDDDAMVFLSGQASDSSQCTQPPAPVQISKAILLGVILGGLILFGVLGNILVILSVA
CHRHLHSVTHYYIVNLAVADLLLTSTVLPFSAIFEVLGYWAFGRVFCNIWAAVDVLCCTA
RIWGLCIISIDRYIGVSYPLRYPTIVTQRRGLMALLCVWALSLVISIGPLFGWRQPAPED
ETICQINEEPGYVLFSALGSFYLPLAIILVMYCRVYVVAKRVRLLSGSREKDRNLRKAAK
TLGIVVGCFVLCWLPFFLVMPIGSFFPDFKPSETVFKIVFWLGYLNSCINPIIYPCSSQE
FKKAFQNVLRIQCLCRKQSSKHALGYTLHPPSQAVEGQHHHHHHHH

Sequence of entity 3 (D), FASTA

>8HN1_3 Nb6 (chains D)
MAQVQLQESGGGLVQAGESLRLSCAASGTIFRLYDMGWYRRVSGNQRELVASITSGGSTK
YGDSVKGRFTISRDNAKNTVYLQMSSLKPEDTAVYYCNAEYRTGIWEELLDGWGQGTQVT
VSSHHHHHHEPEA

Primary citation

Cryo-EM structure of AdTx1-alpha1AAR-Nb6. Liu, X., Shi, M. To be published.

Other PDB entries of the same protein (UniProt P85092 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5MG9 1.8 Å, Putative Ancestral Mamba toxin 1 (AncTx1-W28R/I38S)
4IYE 1.95 Å, Crystal structure of AdTx1 (rho-Da1a) from eastern green mamba (Dendroaspis angusticeps)

Browse structure collections

About this viewer

MolViewer shows 8HN1 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.