8HXR: Nanobody2

Nanobody2 in complex with human BCMA ECD. Determined by X-ray diffraction at 2.7 Å resolution. Released 3 Jan 2024.

Method: X-ray diffraction
Resolution: 2.7 Å
Organisms: Vicugna pacos, Homo sapiens
Chains: 4
Atoms: 2,523
Mol. weight: 39.07 kDa
Released: 3 Jan 2024

Explore 8HXR in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8HXR contains 6 α-helices and 29 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 1 helix, 13 β-strands

Element	Residues	Length	Sheet
β-strand	4-7	4	4
β-strand	10-13	4	5
β-strand	18-24	7	4
β-strand	30-36	7	5
β-strand	43-49	7	5
β-strand	55-57	3	5
β-strand	58	1	6
β-strand	65-70	6	4
β-strand	75-80	6	4
α-helix	85-87	3
β-strand	89-96	8	5
β-strand	107-108	2	5
β-strand	109	1	4
β-strand	112-117	6	5

Chain B: 1 helix, 12 β-strands

Element	Residues	Length	Sheet
β-strand	4-7	4	1
β-strand	10-13	4	2
β-strand	18-24	7	1
β-strand	30-36	7	2
β-strand	43-49	7	2
β-strand	55-57	3	2
β-strand	58	1	3
β-strand	65-70	6	1
β-strand	75-80	6	1
α-helix	85-87	3
β-strand	89-96	8	2
β-strand	107-108	2	2
β-strand	112-117	6	2

Chain C: 2 helices, 2 β-strands

Element	Residues	Length	Sheet
β-strand	12-15	4	6
β-strand	20-23	4	6
α-helix	24-27	4
α-helix	35-38	4

Chain D: 2 helices, 2 β-strands

Element	Residues	Length	Sheet
β-strand	12-15	4	3
β-strand	20-23	4	3
α-helix	24-27	4
α-helix	35-41	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Nanobody2	A, B	protein	124	Vicugna pacos
Tumor necrosis factor receptor superfamily member 17	C, D	protein	54	Homo sapiens	Q02223 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>8HXR_1 Nanobody2 (chains A, B)
EVQLVESGGGLVQAGGSLRLSCAASGRTFTMGWFRQAPGKEREFVAAISLSPTLAYYAES
VKGRFTISRDNAKNTVVLQMNSLKPEDTALYYCAADRKSVMSIRPDYWGQGTQVTVSSHH
HHHH

Sequence of entity 2 (C, D), FASTA

>8HXR_2 Tumor necrosis factor receptor superfamily member 17 (chains C, D)
MLQMAGQCSQNEYFDSLLHACIPCQLRCSSNTPPLTCQRYCNASVTNSVKGTNA

Primary citation

Antigen-induced chimeric antigen receptor multimerization amplifies on-tumor cytotoxicity. Sun, Y., Yang, X.N., Yang, S.S. et al. Signal Transduct Target Ther (2023) 8:445-445. DOI 10.1038/s41392-023-01686-z · PubMed

Other PDB entries of the same protein (UniProt Q02223 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4ZFO 1.9 Å, J22.9-xi: chimeric mouse/human antibody against human BCMA (CD269)
1XU2 2.35 Å, The crystal structure of APRIL bound to BCMA
8HXQ 2.4 Å, Nanobody1 in complex with human BCMA ECD
1OQD 2.6 Å, Crystal structure of sTALL-1 and BCMA
6J7W 2.6 Å, Crystal Structure of Human BCMA in complex with UniAb(TM) VH
8QYA 2.72 Å, J22.9-FNY, fully humanized, CDR optimized Fab Fragment based on chimeric J22.9-xi IgG…
12ER 2.99 Å, Cryo-EM structure of BCMA in complex with the BCMA-targeted Fab arm of teclistamab and…
8QYB 3.09 Å, J22.9-ISY, fully humanized and CDR optimized Fab Fragment based on chimeric J22.9-xi IgG…
8QY9 3.1 Å, J22.9-H, fully humanized Fab Fragment based on chimeric J22.9-xi IgG against BCMA
9MQO 3.18 Å, Crystal structure of BCMA in complex with CA10v2 Fab
12ES 3.43 Å, Cryo-EM structure of BCMA in complex with the BCMA-targeted Fab arm of linvoseltamab and…
2KN1 Solution NMR Structure of BCMA

Browse structure collections

About this viewer

MolViewer shows 8HXR directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.