8K4D: SA2/Scc1/CENP_U complex

Structure of the SA2/Scc1/CENP_U complex. Determined by X-ray diffraction at 3.52 Å resolution. Released 24 Jul 2024.

Method: X-ray diffraction
Resolution: 3.52 Å
Organism: Homo sapiens
Chains: 3
Atoms: 8,141
Mol. weight: 130.74 kDa
Released: 24 Jul 2024

Explore 8K4D in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8K4D contains 60 α-helices and 8 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 54 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	84-89	6
α-helix	95-108	14
α-helix	110-124	15
α-helix	133-138	6
α-helix	141-150	10
α-helix	160-162	3
α-helix	166-186	21
α-helix	197-207	11
β-strand	212	1	1
α-helix	213-252	40
α-helix	261-288	28
α-helix	289-293	5
α-helix	294-296	3
β-strand	299	1	2
α-helix	302-318	17
α-helix	320-323	4
α-helix	326-335	10
α-helix	341-356	16
α-helix	363-377	15
α-helix	378-380	3
β-strand	381	1	3
α-helix	384-400	17
α-helix	408-415	8
α-helix	416-418	3
β-strand	419	1	4
α-helix	422-436	15
α-helix	458-470	13
α-helix	478-483	6
α-helix	489-492	4
α-helix	495-503	9
α-helix	515-533	19
α-helix	537-538	2
α-helix	546-549	4
α-helix	550-577	28
α-helix	582-588	7
α-helix	591-594	4
α-helix	598-601	4
α-helix	606-620	15
α-helix	626-639	14
α-helix	647-672	26
α-helix	681-698	18
α-helix	704-706	3
α-helix	709-722	14
α-helix	727-746	20
α-helix	758-775	18
α-helix	781-797	17
α-helix	800-803	4
α-helix	819-832	14
α-helix	850-873	24
α-helix	879-882	4
α-helix	883-886	4
α-helix	897-908	12
α-helix	912-931	20
α-helix	943-956	14
α-helix	968-981	14
α-helix	999-1007	9
α-helix	1014-1023	10
α-helix	1039-1045	7

Chain B: 5 helices, 4 β-strands

Element	Residues	Length	Sheet
β-strand	326	1	1
β-strand	331	1	2
α-helix	334-342	9
α-helix	344-346	3
β-strand	348	1	3
β-strand	353	1	4
α-helix	358-365	8
α-helix	368-373	6
α-helix	383-391	9

Chain C: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	46-47	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Cohesin subunit SA-2	A	protein	980	Homo sapiens	Q8N3U4 (AlphaFold model)
64-kDa C-terminal product	B	protein	141	Homo sapiens	O60216 (AlphaFold model)
Cenp-U	C	protein	9	Homo sapiens	Q71F23 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>8K4D_1 Cohesin subunit SA-2 (chains A)
NMMLFEVVKMGKSAMQSVVDDWIESYKHDRDIALLDLINFFIQCSGCKGVVTAEMFRHMQ
NSEIIRKMTEEFDEDSGDYPLTMAGPQWKKFKSSFCEFIGVLVRQCQYSIIYDEYMMDTV
ISLLTGLSDSQVRAFRHTSTLAAMKLMTALVNVALNLSINMDNTQRQYEAERNKMIGKRA
NERLELLLQKRKELQENQDEIENMMNAIFKGVFVHRYRDAIAEIRAICIEEIGIWMKMYS
DAFLNDSYLKYVGWTMHDKQGEVRLKCLTALQGLYYNKELNSKLELFTSRFKDRIVSMTL
DKEYDVAVQAIKLLTLVLQSSEEVLTAEDCENVYHLVYSAHRPVAVAAGEFLYKKLFSRR
DPEEDGMMKRRGRQGPNANLVKTLVFFFLESELHEHAAYLVDSMWDCATELLKDWECMNS
LLLEEPLSGEEALTDRQESALIEIMLCTIRQAAECHPPVGRGTGKRVLTAKEKKTQLDDR
TKITELFAVALPQLLAKYSVDAEKVTNLLQLPQYFDLEIYTTGRLEKHLDALLRQIRNIV
EKHTDTDVLEACSKTYHALCNEEFTIFNRVDISRSQLIDELADKFNRLLEDFLQEGEEPD
EDDAYQVLSTLKRITAFHNAHDLSKWDLFACNYKLLKTGIENGDMPEQIVIHALQCTHYV
ILWQLAKITESSSTKEDLLRLKKQMRVFCQICQHYLTNVNTTVKEQAFTILCDILMIFSH
QIMSGGRDMLEPLVYTPDSSLQSELLSFILDHVFIEQDDDNNSADGQQEDEASKIEALHK
RRNLLAAFCKLIVYTVVEMNTAADIFKQYMKYYNDYGDIIKETMSKTRQIDKIQCAKTLI
LSLQQLFNEMIQENGYNFDRSSSTFSGIKELARRFALTFGLDQLKTREAIAMLHKDGIEF
AFKEPNPQGESHPPLNLAFLDILSEFSSKLLRQDKRTVYVYLEKFMTFQMSLRREDVWLP
LMSYRNSLLAGGDDDTMSVI

Sequence of entity 2 (B), FASTA

>8K4D_2 64-kDa C-terminal product (chains B)
MVDPVEPMPTMTDQTTLVPNEEEAFALEPIDITVKETKAKRKRKLIVDSVKELDSKTIRA
QLSDYSDIVTTLDLAPPTKKLMMWKETGGVEKLFSLPAQPLWNNRLLKLFTRCLTPLVPE
DLRKRRKGGEADNLDEFLKEF

Sequence of entity 3 (C), FASTA

>8K4D_3 CENP-U (chains C)
IDVFDFPDN

Primary citation

The CENP-O complex links inner kinetochore to centromere cohesion. Liu, M.J., He, X.J. To be published.

Other PDB entries of the same protein (UniProt Q8N3U4 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6QNX 2.7 Å, Structure of the SA2/SCC1/CTCF complex
4PJW 2.85 Å, crystal structure of human Stromal Antigen 2 (SA2) in complex with Sister Chromatid…
9HMV 2.9 Å, Cryo-EM structure of SA2-SCC1 complex at 2.9 angstrom
4PK7 2.95 Å, crystal structure of human Stromal Antigen 2 (SA2) in complex with Sister Chromatid…
4PJU 3.05 Å, crystal structure of human Stromal Antigen 2 (SA2) in complex with Sister Chromatid…
9HX9 3.07 Å, Structure of the SA2/SCC1/MCM3 complex
9EP3 3.08 Å, Structure of the SA2/SCC1/WAPL complex
7ZJS 3.24 Å, Structural basis of centromeric cohesion protection by SGO1
9HMS 3.4 Å, Cryo-EM structure of human separase bound to SCC1 (310-550 aa) and SA2

Browse structure collections

About this viewer

MolViewer shows 8K4D directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.