8OY1: PDB entry 8OY1

Structure of the human Guanine Nucleotide-Binding Protein G(K) Subunit Alpha. Determined by X-ray diffraction at 3.34 Å resolution. Released 15 May 2024.

Method: X-ray diffraction
Resolution: 3.34 Å
Organism: Homo sapiens
Chains: 1
Atoms: 2,572
Mol. weight: 37.34 kDa
Ligands: GDP
Released: 15 May 2024

Explore 8OY1 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8OY1 contains 17 α-helices and 6 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 17 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	34-40	7	1
α-helix	46-56	11
α-helix	63-91	29
α-helix	100-109	10
α-helix	113-116	4
α-helix	121-132	12
α-helix	134-142	9
α-helix	143-145	3
α-helix	152-157	6
α-helix	159-162	4
α-helix	171-176	6
β-strand	185-190	6	1
β-strand	195-200	6	1
α-helix	208-210	3
α-helix	212-215	4
β-strand	220-226	7	1
α-helix	227-229	3
α-helix	242-254	13
β-strand	263-269	7	1
α-helix	271-280	10
α-helix	296-308	13
β-strand	320-323	4	1
α-helix	329-346	18

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Guanine nucleotide-binding protein G(i) subunit alpha-3	A	protein	321	Homo sapiens	P08754 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>8OY1_1 Guanine nucleotide-binding protein G(i) subunit alpha-3 (chains A)
GAKEVKLLLLGAGESGKSTIVKQMKIIHEDGYSEDECKQYKVVVYSNTIQSIIAIIRAMG
RLKIDFGEAARADDARQLFVLAGSAEEGVMTPELAGVIKRLWRDGGVQACFSRSREYQLN
DSASYYLNDLDRISQSNYIPTQQDVLRTRVKTTGIVETHFTFKDLYFKMFDVGGQRSERK
KWIHCFEGVTAIIFCVALSDYDLVLAEDEEMNRMHESMKLFDSICNNKWFTETSIILFLN
KKDLFEEKIKRSPLTICYPEYTGSNTYEEAAAYIQCQFEDLNRRKDTKEIYTHFTCATDT
KNVQFVFDAVTDVIIKNNLKE

Ligands and cofactors

ID	Name	Formula	Copies
GDP	Guanosine-5'-diphosphate	C10 H15 N5 O11 P2	1

Primary citation

Integrated NMR-crystallography-computational approach for molecular recognition studies of human G alpha i3 protein by a small molecule inhibitor. Ferreras-Gutierrez, M., Minguez-Toral, M., Ibanez de Opakua, A. et al. Int J Biol Macromol (2024) 290:138977-138977. DOI 10.1016/j.ijbiomac.2024.138977 · PubMed

Other PDB entries of the same protein (UniProt P08754 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2ODE 1.9 Å, Crystal structure of the heterodimeric complex of human RGS8 and activated Gi alpha 3
9YCX 2.1 Å, Neurotensin Receptor 1 (NTSR1) bound to Octotensin in complex with Gi3 in the…
9YCY 2.2 Å, Neurotensin Receptor 1 (NTSR1) bound to Octotensin in complex with Gi3 in the Canonical…
8IKL 2.33 Å, Cryo-EM structure of the CD97-G13 complex
8YK0 2.4 Å, Cryo-EM structure of human GPR156-Gi3 complex
7T10 2.5 Å, CryoEM structure of somatostatin receptor 2 in complex with somatostatin-14 and Gi3
9VJ6 2.62 Å, Cryo-EM structure of 5-HT1AR-Gi3 in complex with F-15599
7T11 2.7 Å, CryoEM structure of somatostatin receptor 2 in complex with Octreotide and Gi3.
9VJF 2.7 Å, Cryo-EM structure of 5-HT1AR-Gi3 in complex with buspirone
2IHB 2.71 Å, Crystal structure of the heterodimeric complex of human RGS10 and activated Gi alpha 3
2V4Z 2.8 Å, The crystal structure of the human G-protein subunit alpha (GNAI3) in complex with an…
7KH0 2.8 Å, Cryo-EM structure of the human arginine vasopressin AVP-vasopressin receptor V2R-Gs…

Browse structure collections

About this viewer

MolViewer shows 8OY1 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.