Crystal structure of prefusion-stabilized RSV F Variant DS-Cav1 in complex with Lonafarnib. Determined by X-ray diffraction at 2.29 Å resolution. Released 21 Feb 2024.
Explore 8PHI in 3D Show helices and sheets RCSB PDB PDBe
8PHI contains 19 α-helices and 26 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 29-33 | 5 | 1 |
| β-strand | 38-49 | 12 | 1 |
| β-strand | 51-60 | 10 | 2 |
| α-helix | 74-98 | 25 | |
| α-helix | 138-141 | 4 | |
| α-helix | 149-158 | 10 | |
| α-helix | 163-170 | 8 | |
| β-strand | 176-180 | 5 | 2 |
| β-strand | 186-194 | 9 | 2 |
| α-helix | 195-198 | 4 | |
| α-helix | 199-203 | 5 | |
| α-helix | 204-209 | 6 | |
| α-helix | 218-238 | 21 | |
| β-strand | 243-244 | 2 | 2 |
| α-helix | 247-248 | 2 | |
| α-helix | 254-263 | 10 | |
| α-helix | 268-276 | 9 | |
| α-helix | 278-283 | 6 | |
| β-strand | 286-293 | 8 | 2 |
| β-strand | 296-305 | 10 | 2 |
| β-strand | 308-318 | 11 | 1 |
| β-strand | 321-322 | 2 | 3 |
| β-strand | 333-336 | 4 | 3 |
| β-strand | 340-345 | 6 | 1 |
| β-strand | 348-352 | 5 | 1 |
| α-helix | 355-357 | 3 | |
| β-strand | 359-361 | 3 | 1 |
| β-strand | 364-368 | 5 | 1 |
| α-helix | 369-371 | 3 | |
| β-strand | 373-376 | 4 | 1 |
| α-helix | 377-383 | 7 | |
| β-strand | 394-398 | 5 | 3 |
| β-strand | 404-407 | 4 | 4 |
| β-strand | 411-416 | 6 | 4 |
| β-strand | 422-426 | 5 | 5 |
| β-strand | 430-434 | 5 | 5 |
| α-helix | 435-436 | 2 | |
| β-strand | 438-443 | 6 | 4 |
| β-strand | 449-452 | 4 | 5 |
| β-strand | 455-458 | 4 | 5 |
| α-helix | 459-460 | 2 | |
| β-strand | 465-469 | 5 | 1 |
| α-helix | 474-477 | 4 | |
| β-strand | 490-491 | 2 | 3 |
| α-helix | 492-515 | 24 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Fusion glycoprotein F0 | F | protein | 557 | Human respiratory syncytial virus A2 | P03420 |
>8PHI_1 Fusion glycoprotein F0 (chains F) QNITEEFYQSTCSAVSKGYLSALRTGWYTSVITIELSNIKENKCNGTDAKVKLIKQELDK YKNAVTELQLLMQSTPATNNRARRELPRFMNYTLNNAKKTNVTLSKKRKRRFLGFLLGVG SAIASGVAVCKVLHLEGEVNKIKSALLSTNKAVVSLSNGVSVLTFKVLDLKNYIDKQLLP ILNKQSCSISNIETVIEFQQKNNRLLEITREFSVNAGVTTPVSTYMLTNSELLSLINDMP ITNDQKKLMSNNVQIVRQQSYSIMCIIKEEVLAYVVQLPLYGVIDTPCWKLHTSPLCTTN TKEGSNICLTRTDRGWYCDNAGSVSFFPQAETCKVQSNRVFCDTMNSLTLPSEVNLCNVD IFNPKYDCKIMTSKTDVSSSVITSLGAIVSCYGKTKCTASNKNRGIIKTFSNGCDYVSNK GVDTVSVGNTLYYVNKQEGKSLYVKGEPIINFYDPLVFPSDEFDASISQVNEKINQSLAF IRKSDELLSAIGGYIPEAPRDGQAYVRKDGEWVLLSTFLGGLVPRGSSAWSHPQFEKGGG SGGGSGGGSWSHPQFEK
| ID | Name | Formula | Copies |
|---|---|---|---|
| 336 | 4-{2-[4-(3,10-dibromo-8-chloro-6,11-dihydro-5H-BENZO[5,6]CYCLOHEPTA[1,2-b]pyrid… | C27 H31 Br2 Cl N4 O2 | 1 |
| PG0 | 2-(2-methoxyethoxy)ethanol | C5 H12 O3 | 2 |
| CA | Calcium ion | Ca | 1 |
Water and common crystallization additives (SO4) are not listed.
Drug repurposing screen identifies lonafarnib as respiratory syncytial virus fusion protein inhibitor. Sake, S.M., Zhang, X., Rajak, M.K. et al. Nat Commun (2024) 15:1173-1173. DOI 10.1038/s41467-024-45241-y · PubMed
Other PDB entries of the same protein (UniProt P03420), best resolution first:
MolViewer shows 8PHI directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.