Crystal Structure of BRPF1 bromodomain in complex with acetyl-pyrrole derivative compound 3. Determined by X-ray diffraction at 1.4 Å resolution. Released 11 Sept 2024.
Explore 8QAZ in 3D Show helices and sheets RCSB PDB PDBe
8QAZ contains 5 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 630-647 | 18 | |
| α-helix | 665-667 | 3 | |
| α-helix | 675-683 | 9 | |
| α-helix | 690-707 | 18 | |
| α-helix | 713-737 | 25 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Peregrin | A | protein | 116 | Homo sapiens | P55201 (AlphaFold model) |
>8QAZ_1 Peregrin (chains A) SMEMQLTPFLILLRKTLEQLQEKDTGNIFSEPVPLSEVPDYLDHIKKPMDFFTMKQNLEA YRYLNFDDFEEDFNLIVSNCLKYNAKDTIFYRAAVRLREQGGAVLRQARRQAEKMG
| ID | Name | Formula | Copies |
|---|---|---|---|
| QA5 | 2-[4-[4-ethanoyl-5-methyl-3-(3-methylbutyl)-1~{H}-pyrrol-2-yl]-1,3-thiazol-2-yl… | C16 H23 N5 O S | 1 |
Water and common crystallization additives (NO3) are not listed.
Enhanced cellular death in liver and breast cancer cells by dual BET/BRPF1 inhibitors. Cazzanelli, G., Dalle Vedove, A., Sbardellati, N. et al. Protein Sci (2024) 33:e5191-e5191. DOI 10.1002/pro.5191 · PubMed
Other PDB entries of the same protein (UniProt P55201 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 8QAZ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.