8R3X: APKC Iota kinase domain with LLGL2 peptide

Crystal structure of aPKC Iota kinase domain with LLGL2 peptide. Determined by X-ray diffraction at 2.59 Å resolution. Released 20 Nov 2024.

Method: X-ray diffraction
Resolution: 2.59 Å
Organism: Homo sapiens
Chains: 4
Atoms: 5,721
Mol. weight: 86.94 kDa
Released: 20 Nov 2024

Explore 8R3X in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8R3X contains 43 α-helices and 32 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 22 helices, 15 β-strands

Element	Residues	Length	Sheet
α-helix	251-253	3
β-strand	254-262	9	1
β-strand	266-273	8	1
β-strand	279-286	8	1
α-helix	287-289	3
α-helix	293-308	16
β-strand	315	1	2
β-strand	318-323	6	1
β-strand	327-332	6	1
β-strand	339	1	2
α-helix	340-346	7
α-helix	352-371	20
β-strand	375	1	3
α-helix	381-383	3
β-strand	384-386	3	2
β-strand	392-394	3	2
β-strand	401	1	3
β-strand	410	1	4
β-strand	414-415	2	5
α-helix	417-419	3
α-helix	422-425	4
β-strand	430	1	4
α-helix	433-448	16
α-helix	462-464	3
α-helix	467-476	10
α-helix	480-482	3
α-helix	487-496	10
α-helix	512-517	6
α-helix	520-522	3
α-helix	527-531	5
α-helix	536-537	2
α-helix	549-551	3
α-helix	554-558	5
α-helix	563-566	4
α-helix	568-571	4
α-helix	576-579	4
β-strand	584-585	2	1

Chain B: 21 helices, 15 β-strands

Element	Residues	Length	Sheet
α-helix	251-253	3
β-strand	254-262	9	6
β-strand	266-273	8	6
β-strand	279-286	8	6
α-helix	287-289	3
α-helix	295-309	15
β-strand	315	1	7
β-strand	318-323	6	6
β-strand	327-332	6	6
β-strand	339	1	7
α-helix	340-346	7
α-helix	352-371	20
β-strand	375	1	8
α-helix	381-383	3
β-strand	384-386	3	7
β-strand	392-394	3	7
β-strand	401	1	8
β-strand	410	1	9
β-strand	413-415	3	10
α-helix	417-419	3
α-helix	422-425	4
β-strand	430	1	9
α-helix	433-448	16
α-helix	462-464	3
α-helix	467-476	10
α-helix	480-482	3
α-helix	487-496	10
α-helix	512-517	6
α-helix	520-522	3
α-helix	527-531	5
α-helix	536-537	2
α-helix	549-551	3
α-helix	554-557	4
α-helix	568-571	4
α-helix	576-579	4
β-strand	584-585	2	6

Chain C: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	654-655	2	5

Chain D: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	654-656	3	10

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Protein kinase C iota type	A, B	protein	356	Homo sapiens	P41743 (AlphaFold model)
LLGL scribble cell polarity complex component 2	C, D	protein	20	Homo sapiens	Q6P1M3 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>8R3X_1 Protein kinase C iota type (chains A, B)
ESGKASSSLGLQDFDLLRVIGRGSYAKVLLVRLKKTDRIYAMKVVKKELVNDDEDIDWVQ
TEKHVFEQASNHPFLVGLHSCFQTESRLFFVIEYVNGGDLMFHMQRQRKLPEEHARFYSA
EISLALNYLHERGIIYRDLKLDNVLLDSEGHIKLTDYGMCKEGLRPGDTTSTFCGTPNYI
APEILRGEDYGFSVDWWALGVLMFEMMAGRSPFDIVGSSDNPDQNTEDYLFQVILEKQIR
IPRSLSVKAASVLKSFLNKDPKERLGCHPQTGFADIQGHPFFRNVDWDMMEQKQVVPPFK
PNISGEFGLDNFDSQFTNEPVQLTPDDDDIVRKIDQSEFEGFEYINPLLMSAEECV

Sequence of entity 2 (C, D), FASTA

>8R3X_2 LLGL scribble cell polarity complex component 2 (chains C, D)
SRVKSLKKSLRQSFRRMRKS

Primary citation

Capture, mutual inhibition and release mechanism for aPKC-Par6 and its multisite polarity substrate Lgl. Earl, C.P., Cobbaut, M., Barros-Carvalho, A. et al. Nat Struct Mol Biol (2025) 32:729-739. DOI 10.1038/s41594-024-01425-0 · PubMed

Other PDB entries of the same protein (UniProt P41743 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1WMH 1.5 Å, Crystal structure of a PB1 domain complex of Protein kinase c iota and Par6 alpha
5LI9 1.79 Å, Structure of a nucleotide-bound form of PKCiota core kinase domain
3A8X 2.0 Å, Crystal Structure of PKCiota kinase domain
5LI1 2.0 Å, Structure of a Par3-inhibitory peptide bound to PKCiota core kinase domain
3A8W 2.1 Å, Crystal Structure of PKCiota kinase domain
3ZH8 2.74 Å, A novel small molecule aPKC inhibitor
1ZRZ 3.0 Å, Crystal Structure of the Catalytic Domain of Atypical Protein Kinase C-iota
9EJK 3.08 Å, Lgl2 bound to the aPKCiota-Par6b complex in nucleotide-free form. Head sub-complex…
5LIH 3.25 Å, Structure of a peptide-substrate bound to PKCiota core kinase domain
6ILZ 3.26 Å, Crystal structure of PKCiota in complex with inhibitor
9EJM 3.33 Å, Lgl2 bound to the aPKCiota-Par6B complex in its ADP-bound form
9EJL 3.48 Å, Lgl2 bound to the aPKCiota-Par6B complex in nucleotide-free form. Conformation with…

Browse structure collections

About this viewer

MolViewer shows 8R3X directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.