8R7K: Human UAP56 - TREX-2 complex

Cryo-EM structure of the human UAP56 - TREX-2 complex. Determined by electron microscopy at 3.5 Å resolution. Released 11 Jun 2025.

Method: Electron microscopy
Resolution: 3.5 Å
Organism: Homo sapiens
Chains: 4
Atoms: 7,984
Mol. weight: 152.1 kDa
Ligands: ANP
Released: 11 Jun 2025

Explore 8R7K in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8R7K contains 54 α-helices and 15 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 19 helices, 3 β-strands

Element	Residues	Length	Sheet
α-helix	603-618	16
α-helix	645-651	7
α-helix	694-703	10
α-helix	704-708	5
α-helix	717-737	21
α-helix	744-761	18
α-helix	772-796	25
α-helix	803-813	11
α-helix	820-825	6
α-helix	829-832	4
α-helix	835-844	10
α-helix	852-860	9
α-helix	864-870	7
α-helix	874-888	15
β-strand	897-900	4	1
α-helix	901-907	7
α-helix	913-921	9
β-strand	927-928	2	1
β-strand	931-934	4	1
α-helix	952-955	4
α-helix	962-967	6
α-helix	970-975	6

Chain B: 21 helices, 3 β-strands

Element	Residues	Length	Sheet
α-helix	6-18	13
α-helix	22-29	8
α-helix	47-51	5
α-helix	56-74	19
α-helix	77-96	20
α-helix	105-124	20
α-helix	136-141	6
α-helix	145-154	10
α-helix	169-171	3
α-helix	176-179	4
α-helix	191-196	6
α-helix	208-222	15
α-helix	226-238	13
α-helix	245-258	14
α-helix	268-273	6
α-helix	279-285	7
α-helix	293-300	8
α-helix	311-314	4
α-helix	318-333	16
β-strand	337-339	3	2
α-helix	340-350	11
α-helix	357-370	14
β-strand	376-378	3	2
β-strand	383-385	3	2

Chain C: 2 helices, 0 β-strands

Element	Residues	Length	Sheet
α-helix	20-22	3
α-helix	52-58	7

Chain H: 12 helices, 9 β-strands

Element	Residues	Length	Sheet
α-helix	48-50	3
α-helix	55-58	4
α-helix	70-79	10
β-strand	86-88	3	3
α-helix	95-101	7
α-helix	103-106	4
β-strand	116-119	4	4
α-helix	123-136	14
β-strand	145-148	4	4
α-helix	155-163	9
β-strand	168-171	4	4
α-helix	173-180	8
β-strand	192-195	4	4
β-strand	196	1	3
α-helix	198-202	5
α-helix	208-214	7
β-strand	223-224	2	4
β-strand	227-228	2	3
α-helix	236-239	4
α-helix	240-242	3
β-strand	248-249	2	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Germinal-center associated nuclear protein	A	protein	423	Homo sapiens	O60318 (AlphaFold model)
PCI domain-containing protein 2	B	protein	399	Homo sapiens	Q5JVF3 (AlphaFold model)
26S proteasome complex subunit SEM1	C	protein	70	Homo sapiens	P60896 (AlphaFold model)
Spliceosome RNA helicase DDX39B	H	protein	428	Homo sapiens	Q13838 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>8R7K_1 Germinal-center associated nuclear protein (chains A)
SEGLGPCVLSLSTLIGTVAETSKEKYRLLDQRDRIMRQARVKRTDLDKARTFVGTCLDMC
PEKERYMRETRSQLSVFEVVPGTDQVDHAAAVKEYSRSSADQEEPLPHELRPLPVLSRTM
DYLVTQIMDQKEGSLRDWYDFVWNRTRGIRKDITQQHLCDPLTVSLIEKCTRFHIHCAHF
MCEEPMSSFDAKINNENMTKCLQSLKEMYQDLRNKGVFCASEAEFQGYNVLLSLNKGDIL
REVQQFHPAVRNSSEVKFAVQAFAALNSNNFVRFFKLVQSASYLNACLLHCYFSQIRKDA
LRALNFAYTVSTQRSTIFPLDGVVRMLLFRDCEEATDFLTCHGLTVSDGCVELNRSAFLE
PEGLSKTRKSVFITRKLTVSVGEIVNGGPLPPVPRHTPVCSFNSQNKYIGESLAAELPVS
TQR

Sequence of entity 2 (B), FASTA

>8R7K_2 PCI domain-containing protein 2 (chains B)
MAHITINQYLQQVYEAIDSRDGASCAELVSFKHPHVANPRLQMASPEEKCQQVLEPPYDE
MFAAHLRCTYAVGNHDFIEAYKCQTVIVQSFLRAFQAHKEENWALPVMYAVALDLRVFAN
NADQQLVKKGKSKVGDMLEKAAELLMSCFRVCASDTRAGIEDSKKWGMLFLVNQLFKIYF
KINKLHLCKPLIRAIDSSNLKDDYSTAQRVTYKYYVGRKAMFDSDFKQAEEYLSFAFEHC
HRSSQKNKRMILIYLLPVKMLLGHMPTVELLKKYHLMQFAEVTRAVSEGNLLLLHEALAK
HEAFFIRCGIFLILEKLKIITYRNLFKKVYLLLKTHQLSLDAFLVALKFMQVEDVDIDEV
QCILANLIYMGHVKGYISHQHQKLVVSKQNPFPPLSTVC

Sequence of entity 3 (C), FASTA

>8R7K_3 26S proteasome complex subunit SEM1 (chains C)
MSEKKQPVDLGLLEEDDEFEEFPAEDWAGLDEDEDAHVWEDNWDDDNVEDDFSNQLRAEL
EKHGYKMETS

Sequence of entity 4 (H), FASTA

>8R7K_4 Spliceosome RNA helicase DDX39B (chains H)
MAENDVDNELLDYEDDEVETAAGGDGAEAPAKKDVKGSYVSIHSSGFRDFLLKPELLRAI
VDCGFEHPSEVQHECIPQAILGMDVLCQAKSGMGKTAVFVLATLQQLEPVTGQVSVLVMC
HTRELAFQISKEYERFSKYMPNVKVAVFFGGLSIKKDEEVLKKNCPHIVVGTPGRILALA
RNKSLNLKHIKHFILDECDKMLEQLDMRRDVQEIFRMTPHEKQVMMFSATLSKEIRPVCR
KFMQDPMEIFVDDETKLTLHGLQQYYVKLKDNEKNRKLFDLLDVLEFNQVVIFVKSVQRC
IALAQLLVEQNFPAIAIHRGMPQEERLSRYQQFKDFQRRILVATNLFGRGMDIERVNIAF
NYDMPEDSDTYLHRVARAGRFGTKGLAITFVSDENDAKILNDVQDRFEVNISELPDEIDI
SSYIEQTR

Ligands and cofactors

ID	Name	Formula	Copies
ANP	Phosphoaminophosphonic acid-adenylate ester	C10 H17 N6 O12 P3	1

Primary citation

An ATP-gated molecular switch orchestrates human messenger RNA export. Hohmann, U., Graf, M., Tirian, L. et al. Nature (2025). DOI 10.1038/s41586-025-09832-z · PubMed

Other PDB entries of the same protein (UniProt O60318 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4DHX 2.1 Å, ENY2:GANP complex
9DLP 2.79 Å, Cryo-EM structure of human TREX-2 complex bound to DDX39B(UAP56)
9T6N 3.0 Å, Cryo-EM structure of the human GANP-PCID2-DSS1 complex bound to UAP56
9UPC 3.14 Å, Structure of human TREX-2
9UPB 3.41 Å, Structure of the human TREX-2 bound to UAP56
8R7J 3.5 Å, Cryo-EM structure of the human TREX-2 complex

Browse structure collections

About this viewer

MolViewer shows 8R7K directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.