8RBX: Integrator-PP2A

Structure of Integrator-PP2A bound to a paused RNA polymerase II-DSIF-NELF-nucleosome complex. Determined by electron microscopy at 4.1 Å resolution. Released 7 Feb 2024.

Method: Electron microscopy
Resolution: 4.1 Å
Organisms: Sus scrofa, Homo sapiens, synthetic construct
Chains: 46
Atoms: 129,226
Mol. weight: 2703.21 kDa
Ligands: ZN, MG, MN
Released: 7 Feb 2024

Explore 8RBX in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8RBX contains 974 α-helices and 469 β-strands across 42 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain a: 110 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	119-121	3
α-helix	122-132	11
α-helix	135-151	17
α-helix	158-170	13
α-helix	172-176	5
α-helix	178-188	11
α-helix	190-191	2
α-helix	203-215	13
α-helix	225-235	11
α-helix	244-246	3
α-helix	247-257	11
α-helix	261-263	3
α-helix	322-338	17
α-helix	343-345	3
α-helix	352-355	4
α-helix	367-374	8
α-helix	382-397	16
α-helix	404-409	6
α-helix	417-432	16
α-helix	434-451	18
α-helix	456-468	13
α-helix	473-487	15
α-helix	492-505	14
α-helix	512-519	8
α-helix	527-529	3
α-helix	532-547	16
α-helix	555-566	12
α-helix	572-599	28
α-helix	605-615	11
α-helix	636-642	7
α-helix	650-661	12
α-helix	669-684	16
α-helix	700-711	12
α-helix	730-741	12
α-helix	755-759	5
α-helix	761-773	13
α-helix	782-814	33
α-helix	849-859	11
α-helix	947-955	9
α-helix	965-975	11
α-helix	976-980	5
α-helix	984-998	15
α-helix	1027-1031	5
α-helix	1037-1039	3
α-helix	1043-1056	14
α-helix	1060-1072	13
α-helix	1079-1095	17
α-helix	1098-1103	6
α-helix	1111-1133	23
β-strand	1149-1153	5	1
β-strand	1159-1163	5	1
α-helix	1164-1173	10
α-helix	1184-1193	10
α-helix	1199-1201	3
β-strand	1202-1205	4	1
β-strand	1210-1211	2	1
α-helix	1217-1225	9
α-helix	1229-1236	8
α-helix	1241-1248	8
α-helix	1255-1271	17
α-helix	1273-1279	7
α-helix	1284-1295	12
α-helix	1302-1311	10
α-helix	1362-1368	7
α-helix	1374-1392	19
α-helix	1402-1414	13
α-helix	1421-1426	6
α-helix	1429-1445	17
α-helix	1452-1467	16
α-helix	1470-1472	3
α-helix	1476-1491	16
α-helix	1493-1494	2
α-helix	1497-1509	13
α-helix	1514-1529	16
α-helix	1538-1551	14
α-helix	1556-1564	9
α-helix	1579-1588	10
α-helix	1615-1625	11
α-helix	1634-1641	8
α-helix	1657-1667	11
α-helix	1670-1682	13
α-helix	1691-1702	12
α-helix	1705-1708	4
α-helix	1729-1747	19
α-helix	1755-1760	6
α-helix	1762-1769	8
α-helix	1773-1790	18
α-helix	1794-1809	16
α-helix	1815-1818	4
α-helix	1819-1823	5
α-helix	1826-1828	3
α-helix	1836-1847	12
α-helix	1853-1872	20
α-helix	1874-1878	5
α-helix	1881-1890	10
α-helix	1896-1901	6
α-helix	1905-1918	14
α-helix	1925-1944	20
α-helix	1949-1951	3
α-helix	1953-1969	17
α-helix	1971-1980	10
α-helix	1982-1991	10
α-helix	1996-2004	9
α-helix	2043-2055	13
α-helix	2060-2076	17
α-helix	2078-2082	5
α-helix	2085-2091	7
α-helix	2097-2113	17
α-helix	2117-2121	5
α-helix	2122-2130	9
α-helix	2134-2142	9
α-helix	2144-2149	6
α-helix	2155-2168	14
α-helix	2174-2188	15

Chain A: 75 helices, 69 β-strands

Element	Residues	Length	Sheet
α-helix	14-15	2
β-strand	20-22	3	2
β-strand	25	1	3
α-helix	28-34	7
β-strand	47-48	2	4
β-strand	51-52	2	4
β-strand	86-94	9	5
α-helix	97-99	3
α-helix	100-109	10
β-strand	110	1	6
β-strand	117	1	6
α-helix	124-133	10
α-helix	137-148	12
α-helix	186-188	3
β-strand	190-194	5	7
β-strand	197-201	5	7
β-strand	214-216	3	7
α-helix	218-226	9
α-helix	230-236	7
α-helix	245-247	3
β-strand	250-255	6	5
α-helix	275-292	18
α-helix	293-297	5
α-helix	300-318	19
α-helix	326-327	2
β-strand	329	1	8
β-strand	335	1	8
α-helix	339-344	6
α-helix	350-355	6
β-strand	357-359	3	9
β-strand	362-369	8	10
β-strand	377-380	4	10
α-helix	382-387	6
β-strand	389-393	5	11
α-helix	394	1
α-helix	399-408	10
β-strand	416-420	5	11
β-strand	426-428	3	11
α-helix	435-438	4
β-strand	445-449	5	11
β-strand	455-459	5	10
α-helix	466-468	3
β-strand	469-476	8	10
β-strand	482-484	3	10
α-helix	486-489	4
β-strand	500-504	5	10
α-helix	509-518	10
β-strand	520	1	10
α-helix	522-524	3
β-strand	526-527	2	12
β-strand	532-533	2	12
α-helix	539-548	10
β-strand	554-555	2	13
α-helix	557-564	8
α-helix	573-574	2
β-strand	575	1	14
α-helix	576-577	2
β-strand	579-581	3	15
β-strand	585	1	15
β-strand	586-587	2	13
α-helix	588-595	8
β-strand	602-605	4	16
α-helix	612-614	3
β-strand	627-630	4	16
β-strand	635-637	3	16
α-helix	642-645	4
α-helix	652-660	9
α-helix	663-683	21
β-strand	686	1	17
α-helix	689-692	4
α-helix	696-722	27
α-helix	725-728	4
α-helix	733-758	26
α-helix	765-771	7
α-helix	778-785	8
β-strand	789-790	2	18
β-strand	793	1	19
β-strand	796	1	19
α-helix	818-820	3
β-strand	822-823	2	18
α-helix	833-867	35
β-strand	872-873	2	20
β-strand	879-880	2	20
β-strand	886-888	3	20
β-strand	896	1	21
β-strand	902-905	4	22
α-helix	913-920	8
α-helix	927-933	7
β-strand	934	1	23
α-helix	936-944	9
α-helix	946-969	24
β-strand	976-979	4	22
α-helix	983-993	11
α-helix	1001	1
β-strand	1002	1	23
α-helix	1006-1019	14
α-helix	1028-1037	10
α-helix	1039-1048	10
α-helix	1051-1053	3
α-helix	1054-1058	5
α-helix	1062-1078	17
β-strand	1080	1	21
α-helix	1081-1082	2
α-helix	1087-1101	15
α-helix	1120-1128	9
β-strand	1139-1142	4	24
β-strand	1143	1	25
α-helix	1144	1
α-helix	1145-1148	4
α-helix	1151-1159	9
β-strand	1164	1	26
α-helix	1166-1169	4
β-strand	1173-1176	4	27
β-strand	1177	1	28
β-strand	1210	1	28
β-strand	1212-1215	4	27
α-helix	1218-1224	7
α-helix	1228-1239	12
α-helix	1240-1242	3
β-strand	1244-1247	4	27
β-strand	1256-1260	5	27
α-helix	1281-1294	14
β-strand	1299	1	26
β-strand	1306-1310	5	24
β-strand	1319-1322	4	29
β-strand	1328-1331	4	29
β-strand	1335-1339	5	24
α-helix	1343-1348	6
β-strand	1352	1	25
β-strand	1358-1359	2	24
α-helix	1363-1369	7
α-helix	1371-1388	18
α-helix	1395-1404	10
β-strand	1408	1	30
β-strand	1410	1	30
α-helix	1416-1419	4
α-helix	1426-1432	7
α-helix	1435-1445	11
β-strand	1448-1449	2	2
α-helix	1454-1459	6
α-helix	1462-1464	3
α-helix	1467-1469	3
β-strand	1471-1475	5	31
α-helix	1479-1482	4

Chain b: 81 helices, 0 β-strands

Element	Residues	Length
α-helix	16-19	4
α-helix	20-28	9
α-helix	31-34	4
α-helix	39-54	16
α-helix	62-74	13
α-helix	75-77	3
α-helix	81-88	8
α-helix	92-106	15
α-helix	126-131	6
α-helix	135-155	21
α-helix	175-187	13
α-helix	194-203	10
α-helix	207-217	11
α-helix	219-221	3
α-helix	222-230	9
α-helix	241-256	16
α-helix	258-260	3
α-helix	261-271	11
α-helix	275-285	11
α-helix	297-307	11
α-helix	311-326	16
α-helix	335-350	16
α-helix	381-397	17
α-helix	405-415	11
α-helix	423-438	16
α-helix	440-442	3
α-helix	446-461	16
α-helix	476-488	13
α-helix	492-503	12
α-helix	512-520	9
α-helix	521-525	5
α-helix	528-537	10
α-helix	539-540	2
α-helix	553-562	10
α-helix	565-568	4
α-helix	574-582	9
α-helix	588-589	2
α-helix	592-603	12
α-helix	610-614	5
α-helix	616-622	7
α-helix	645-664	20
α-helix	665-668	4
α-helix	678-680	3
α-helix	681-686	6
α-helix	689-698	10
α-helix	700-703	4
α-helix	705-717	13
α-helix	719-721	3
α-helix	724-728	5
α-helix	736-744	9
α-helix	749-751	3
α-helix	754-762	9
α-helix	768-778	11
α-helix	787-789	3
α-helix	790-795	6
α-helix	797-800	4
α-helix	807-820	14
α-helix	825-833	9
α-helix	834-836	3
α-helix	850-855	6
α-helix	857-862	6
α-helix	865-869	5
α-helix	871-900	30
α-helix	923-945	23
α-helix	948-949	2
α-helix	950-953	4
α-helix	989-1007	19
α-helix	1009-1018	10
α-helix	1022-1024	3
α-helix	1025-1031	7
α-helix	1033-1040	8
α-helix	1042-1046	5
α-helix	1051-1067	17
α-helix	1071-1086	16
α-helix	1087-1089	3
α-helix	1093-1103	11
α-helix	1105-1113	9
α-helix	1115-1117	3
α-helix	1118-1138	21
α-helix	1145-1148	4
α-helix	1181-1200	20

Chain B: 54 helices, 81 β-strands

Element	Residues	Length	Sheet
α-helix	19-36	18
α-helix	41-49	9
α-helix	50-54	5
α-helix	55-61	7
α-helix	63-65	3
β-strand	66-67	2	32
β-strand	84-93	10	32
β-strand	97-98	2	33
β-strand	106-107	2	33
α-helix	110-116	7
β-strand	121-131	11	32
β-strand	141-153	13	32
α-helix	168-173	6
β-strand	185-187	3	34
β-strand	190-194	5	34
α-helix	195	1
β-strand	196-200	5	35
α-helix	201	1
β-strand	205-208	4	36
β-strand	215-223	9	36
α-helix	230-232	3
β-strand	233-240	8	36
β-strand	256-259	4	36
β-strand	263	1	37
β-strand	267-268	2	36
α-helix	269-275	7
α-helix	282-288	7
α-helix	296-300	5
α-helix	302-305	4
α-helix	306-308	3
α-helix	314-323	10
β-strand	325	1	37
α-helix	332-341	10
α-helix	342-346	5
α-helix	358-377	20
α-helix	381-384	4
α-helix	388-390	3
β-strand	391-394	4	35
α-helix	396-423	28
α-helix	431-434	4
α-helix	438-450	13
β-strand	453	1	38
β-strand	463	1	38
β-strand	467-469	3	34
α-helix	475-482	8
β-strand	484-486	3	35
α-helix	503-505	3
β-strand	509	1	39
β-strand	523-525	3	35
β-strand	526	1	39
β-strand	531-532	2	40
α-helix	539-547	9
β-strand	551	1	41
α-helix	553-555	3
α-helix	558-562	5
β-strand	565-569	5	41
β-strand	572-577	6	41
α-helix	580-592	13
β-strand	602-606	5	41
β-strand	611-615	5	41
β-strand	621-627	7	40
β-strand	628-629	2	42
β-strand	632-633	2	42
α-helix	637-644	8
α-helix	646-649	4
α-helix	653-658	6
β-strand	662-666	5	40
α-helix	667-670	4
β-strand	675-676	2	40
α-helix	679-682	4
β-strand	695-696	2	40
α-helix	700-703	4
α-helix	706-710	5
α-helix	714-716	3
α-helix	719-729	11
β-strand	732	1	43
β-strand	747-751	5	44
β-strand	755	1	45
β-strand	759-760	2	46
α-helix	762-765	4
β-strand	776-782	7	47
β-strand	783	1	17
β-strand	793-797	5	47
α-helix	798-802	5
β-strand	808-817	10	44
β-strand	820	1	48
β-strand	826	1	48
β-strand	827-829	3	49
β-strand	837-838	2	49
α-helix	845-847	3
β-strand	848	1	50
β-strand	853	1	51
β-strand	854	1	50
α-helix	855	1
β-strand	858-860	3	44
β-strand	865-867	3	51
β-strand	869-872	4	49
β-strand	889-891	3	49
β-strand	894-895	2	51
β-strand	902-911	10	44
β-strand	917-927	11	44
β-strand	934-937	4	47
β-strand	942-949	8	47
β-strand	956	1	52
β-strand	965-967	3	47
α-helix	969-971	3
α-helix	978-993	16
β-strand	997-998	2	46
α-helix	1008-1016	9
β-strand	1025-1026	2	47
β-strand	1029	1	52
α-helix	1035	1
β-strand	1036	1	52
α-helix	1037	1
α-helix	1040	1
β-strand	1041-1050	10	47
β-strand	1051	1	43
β-strand	1060-1062	3	10
β-strand	1067	1	53
β-strand	1074	1	53
β-strand	1084-1086	3	9
α-helix	1088-1097	10
α-helix	1100-1104	5
α-helix	1105-1109	5
β-strand	1113-1119	7	54
β-strand	1125	1	54
α-helix	1126	1
β-strand	1127-1129	3	55
β-strand	1134-1136	3	55
β-strand	1137	1	56
β-strand	1142	1	56
β-strand	1146-1152	7	54
α-helix	1153-1164	12
β-strand	1167	1	3
β-strand	1170-1172	3	2

Chain C: 10 helices, 13 β-strands

Element	Residues	Length	Sheet
β-strand	8-14	7	62
β-strand	18-24	7	62
α-helix	28-40	13
β-strand	44-55	12	63
α-helix	61-69	9
β-strand	73	1	64
β-strand	99-106	8	63
β-strand	113-115	3	65
α-helix	117-119	3
β-strand	121-122	2	63
β-strand	129	1	64
α-helix	130-132	3
α-helix	146-149	4
β-strand	151-153	3	65
β-strand	158-168	11	63
α-helix	174-176	3
β-strand	179-182	4	62
β-strand	185-186	2	62
α-helix	200-202	3
α-helix	204-206	3
α-helix	218-220	3
β-strand	228-235	8	62
α-helix	241-270	30

Chain d: 52 helices, 15 β-strands

Element	Residues	Length	Sheet
α-helix	37-42	6
α-helix	51-59	9
α-helix	66-82	17
α-helix	86-100	15
α-helix	108-118	11
α-helix	124-140	17
α-helix	145-157	13
α-helix	164-176	13
α-helix	196-202	7
α-helix	203-205	3
α-helix	209-224	16
α-helix	233-241	9
α-helix	247-262	16
β-strand	267	1	57
β-strand	278	1	57
α-helix	279-289	11
α-helix	290-292	3
α-helix	296-308	13
α-helix	314-321	8
α-helix	378-383	6
α-helix	388-404	17
α-helix	406-410	5
α-helix	413-418	6
α-helix	419-421	3
α-helix	425-438	14
α-helix	446-454	9
α-helix	455-457	3
α-helix	461-473	13
α-helix	479-495	17
α-helix	497-499	3
α-helix	500-513	14
α-helix	515-518	4
α-helix	519-521	3
α-helix	522-525	4
α-helix	533-535	3
α-helix	542-554	13
α-helix	555-557	3
α-helix	562-564	3
α-helix	567-579	13
α-helix	609-623	15
α-helix	629-649	21
α-helix	654-674	21
α-helix	693-709	17
β-strand	711	1	58
α-helix	716-740	25
α-helix	744-764	21
α-helix	769-771	3
α-helix	776-781	6
α-helix	784-787	4
α-helix	792-804	13
α-helix	806-810	5
α-helix	812-814	3
β-strand	819	1	58
β-strand	821-824	4	59
β-strand	835-838	4	60
β-strand	842-852	11	59
α-helix	857-860	4
β-strand	861-866	6	60
β-strand	872-875	4	60
α-helix	879-881	3
β-strand	882-886	5	59
β-strand	889-899	11	59
β-strand	903	1	61
β-strand	907-916	10	60
β-strand	945-947	3	60
α-helix	950-951	2
β-strand	952-959	8	60

Chain D: 8 helices, 5 β-strands

Element	Residues	Length	Sheet
β-strand	16	1	70
β-strand	21	1	70
α-helix	24-28	5
β-strand	30-31	2	31
α-helix	34-49	16
α-helix	54-58	5
α-helix	59-71	13
α-helix	77-87	11
α-helix	94-103	10
α-helix	108-114	7
β-strand	119	1	71
β-strand	122	1	71
α-helix	124-137	14

Chain e: 60 helices, 7 β-strands

Element	Residues	Length	Sheet
α-helix	28-40	13
β-strand	42	1	66
β-strand	49	1	66
α-helix	52-63	12
α-helix	67-69	3
α-helix	70-94	25
α-helix	119-135	17
α-helix	137-159	23
α-helix	172-182	11
α-helix	185-199	15
α-helix	205-218	14
α-helix	224-233	10
α-helix	236-253	18
α-helix	291-302	12
α-helix	307-319	13
α-helix	340-347	8
α-helix	349-351	3
α-helix	352-361	10
α-helix	367-376	10
α-helix	381-397	17
α-helix	403-414	12
α-helix	429-450	22
α-helix	472-477	6
α-helix	478-480	3
α-helix	481-488	8
α-helix	495-509	15
α-helix	515-525	11
α-helix	529-543	15
α-helix	549-562	14
α-helix	568-586	19
α-helix	590-595	6
α-helix	599-603	5
α-helix	604-606	3
α-helix	607-610	4
α-helix	612-615	4
α-helix	619-631	13
α-helix	633-635	3
α-helix	641-662	22
α-helix	664-666	3
α-helix	668-679	12
α-helix	682-696	15
α-helix	703-705	3
α-helix	727-734	8
β-strand	752-753	2	67
α-helix	759-760	2
α-helix	769-787	19
β-strand	788	1	68
α-helix	789-790	2
α-helix	802-803	2
β-strand	804	1	68
α-helix	805	1
α-helix	806-820	15
α-helix	831-833	3
α-helix	834-838	5
α-helix	841-853	13
α-helix	856-866	11
α-helix	868-874	7
α-helix	875-890	16
α-helix	897-899	3
α-helix	901-916	16
α-helix	924-926	3
α-helix	936-952	17
β-strand	961-963	3	69
β-strand	968-970	3	69
α-helix	973-976	4
α-helix	982-994	13
α-helix	1001-1006	6

34 more chain groups are not listed. Open the entry in the viewer and use the sequence panel to see them.

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Unk-unk-unk-unk-unk-unk-unk-unk	1	protein	8	Sus scrofa
DNA-directed RNA polymerase subunit	A, Y	protein	1970	Sus scrofa	A0A8D1DPV6
DNA-directed RNA polymerase subunit beta	B	protein	1174	Sus scrofa	Q9H0H0 (AlphaFold model)
DNA-directed RNA polymerase II subunit RPB3	C	protein	275	Sus scrofa	I3LCH3 (AlphaFold model)
RNA polymerase II subunit D	D	protein	142	Sus scrofa	A0A287ADR4 (AlphaFold model)
DNA-directed RNA polymerase II subunit E	E	protein	210	Sus scrofa	I3LSI7
DNA-directed RNA polymerases I, II, and III subunit RPABC2	F	protein	127	Sus scrofa	A0A4X1VEK9
DNA-directed RNA polymerase II subunit RPB7	G	protein	172	Sus scrofa	A0A4X1VKG7
DNA-directed RNA polymerases I, II, and III subunit RPABC3	H	protein	150	Sus scrofa	I3LCB2
DNA-directed RNA polymerase II subunit RPB9	I	protein	125	Sus scrofa	P60899
DNA-directed RNA polymerases I, II, and III subunit RPABC5	J	protein	67	Sus scrofa	A0A4X1VYD0
DNA-directed RNA polymerase II subunit RPB11-a	K	protein	117	Sus scrofa	F1RKE4

29 more molecules are not listed.

Sequence of entity 1 (1), FASTA

>8RBX_1 UNK-UNK-UNK-UNK-UNK-UNK-UNK-UNK (chains 1)
XXXXXXXX

Sequence of entity 2 (A, Y), FASTA

>8RBX_2 DNA-directed RNA polymerase subunit (chains A, Y)
MHGGGPPSGDSACPLRTIKRVQFGVLSPDELKRMSVTEGGIKYPETTEGGRPKLGGLMDP
RQGVIERTGRCQTCAGNMTECPGHFGHIELAKPVFHVGFLVKTMKVLRCVCFFCSKLLVD
SNNPKIKDILAKSKGQPKKRLTHVYDLCKGKNICEGGEEMDNKFGVEQPEGDEDLTKEKG
HGGCGRYQPRIRRSGLELYAEWKHVNEDSQEKKILLSPERVHEIFKRISDEECFVLGMEP
RYARPEWMIVTVLPVPPLSVRPAVVMQGSARNQDDLTHKLADIVKINNQLRRNEQNGAAA
HVIAEDVKLLQFHVATMVDNELPGLPRAMQKSGRPLKSLKQRLKGKEGRVRGNLMGKRVD
FSARTVITPDPNLSIDQVGVPRSIAANMTFAEIVTPFNIDRLQELVRRGNSQYPGAKYII
RDNGDRIDLRFHPKPSDLHLQTGYKVERHMCDGDIVIFNRQPTLHKMSMMGHRVRILPWS
TFRLNLSVTTPYNADFDGDEMNLHLPQSLETRAEIQELAMVPRMIVTPQSNRPVMGIVQD
TLTAVRKFTKRDVFLERGEVMNLLMFLSTWDGKVPQPAILKPRPLWTGKQIFSLIIPGHI
NCIRTHSTHPDDEDSGPYKHISPGDTKVVVENGELIMGILCKKSLGTSAGSLVHISYLEM
GHDITRLFYSNIQTVINNWLLIEGHTIGIGDSIADSKTYQDIQNTIKKAKQDVIEVIEKA
HNNELEPTPGNTLRQTFENQVNRILNDARDKTGSSAQKSLSEYNNFKSMVVSGAKGSKIN
ISQVIAVVGQQNVEGKRIPFGFKHRTLPHFIKDDYGPESRGFVENSYLAGLTPTEFFFHA
MGGREGLIDTAVKTAETGYIQRRLIKSMESVMVKYDATVRNSINQVVQLRYGEDGLAGES
VEFQNLATLKPSNKAFEKKFRFDYTNERALRRTLQEDLVKDVLSNAHIQNELEREFERMR
EDREVLRVIFPTGDSKVVLPCNLLRMIWNAQKIFHINPRLPSDLHPIKVVEGVKELSKKL
VIVNGDDPLSRQAQENATLLFNIHLRSTLCSRRMAEEFRLSGEAFDWLLGEIESKFNQAI
AHPGEMVGALAAQSLGEPATQMTLNTFHYAGVSAKNVTLGVPRLKELINISKKPKTPSLT
VFLLGQSARDAERAKDILCRLEHTTLRKVTANTAIYYDPNPQSTVVAEDQEWVNVYYEMP
DFDVARISPWLLRVELDRKHMTDRKLTMEQIAEKINAGFGDDLNCIFNDDNAEKLVLRIR
IMNSDENKMQEEEEVVDKMDDDVFLRCIESNMLTDMTLQGIEQISKVYMHLPQTDNKKKI
IITEDGEFKALQEWILETDGVSLMRVLSEKDVDPVRTTSNDIVEIFTVLGIEAVRKALER
ELYHVISFDGSYVNYRHLALLCDTMTCRGHLMAITRHGVNRQDTGPLMKCSFEETVDVLM
EAAAHGESDPMKGVSENIMLGQLAPAGTGCFDLLLDAEKCKYGMEIPTNIPGLGAAGPTG
MFFGSAPSPMGGISPAMTPWNQGATPAYGAWSPSVGSGMTPGAAGFSPSAASDASGFSPG
YSPAWSPTPGSPGSPGPSSPYIPSPGGAMSPSYSPTSPAYEPRSPGGYTPQSPSYSPTSP
SYSPTSPSYSPTSPNYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSP
TSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPS
YSPTSPNYSPTSPNYTPTSPSYSPTSPSYSPTSPNYTPTSPNYSPTSPSYSPTSPSYSPT
SPSYSPSSPRYTPQSPTYTPSSPSYSPSSPSYSPTSPKYTPTSPSYSPSSPEYTPTSPKY
SPTSPKYSPTSPKYSPTSPTYSPTTPKYSPTSPTYSPTSPVYTPTSPKYSPTSPTYSPTS
PKYSPTSPTYSPTSPKGSTYSPTSPGYSPTSPTYSLTSPAISPDDSDEEN

Sequence of entity 3 (B), FASTA

>8RBX_3 DNA-directed RNA polymerase subunit beta (chains B)
MYDADEDMQYDEDDDEITPDLWQEACWIVISSYFDEKGLVRQQLDSFDEFIQMSVQRIVE
DAPPIDLQAEAQHASGEVEEPPRYLLKFEQIYLSKPTHWERDGAPSPMMPNEARLRNLTY
SAPLYVDITKTVIKEGEEQLQTQHQKTFIGKIPIMLRSTYCLLNGLTDRDLCELNECPLD
PGGYFIINGSEKVLIAQEKMATNTVYVFAKKDSKYAYTGECRSCLENSSRPTSTIWVSML
ARGGQGAKKSAIGQRIVATLPYIKQEVPIIIVFRALGFVSDRDILEHIIYDFEDPEMMEM
VKPSLDEAFVIQEQNVALNFIGSRGAKPGVTKEKRIKYAKEVLQKEMLPHVGVSDFCETK
KAYFLGYMVHRLLLAALGRRELDDRDHYGNKRLDLAGPLLAFLFRGMFKNLLKEVRIYAQ
KFIDRGKDFNLELAIKTRIISDGLKYSLATGNWGDQKKAHQARAGVSQVLNRLTFASTLS
HLRRLNSPIGRDGKLAKPRQLHNTLWGMVCPAETPEGHAVGLVKNLALMAYISVGSQPSP
ILEFLEEWSMENLEEISPAAIADATKIFVNGCWVGIHKDPEQLMNTLRKLRRQMDIIVSE
VSMIRDIREREIRIYTDAGRICRPLLIVEKQKLLLKKRHIDQLKEREYNNYSWQDLVASG
VVEYIDTLEEETVMLAMTPDDLQEKEVAYCSTYTHCEIHPSMILGVCASIIPFPDHNQSP
RNTYQSAMGKQAMGVYITNFHVRMDTLAHVLYYPQKPLVTTRSMEYLRFRELPAGINSIV
AIASYTGYNQEDSVIMNRSAVDRGFFRSVFYRSYKEQESKKGFDQEEVFEKPTRETCQGM
RHAIYDKLDDDGLIAPGVRVSGDDVIIGKTVTLPENEDELEGTNRRYTKRDCSTFLRTSE
TGIVDQVMVTLNQEGYKFCKIRVRSVRIPQIGDKFASRHGQKGTCGIQYRQEDMPFTCEG
ITPDIIINPHAIPSRMTIGHLIECLQGKVSANKGEIGDATPFNDAVNVQKISNLLSDYGY
HLRGNEVLYNGFTGRKITSQIFIGPTYYQRLKHMVDDKIHSRARGPIQILNRQPMEGRSR
DGGLRFGEMERDCQIAHGAAQFLRERLFEASDPYQVHVCNLCGIMAIANTRTHTYECRGC
RNKTQISLVRMPYACKLLFQELMSMSIAPRMMSV

Sequence of entity 4 (C), FASTA

>8RBX_4 DNA-directed RNA polymerase II subunit RPB3 (chains C)
MPYANQPTVRITELTDENVKFIIENTDLAVANSIRRVFIAEVPIIAIDWVQIDANSSVLH
DEFIAHRLGLIPLTSDDIVDKLQYSRDCTCEEFCPECSVEFTLDVRCNEDQTRHVTSRDL
ISNSPRVIPVTSRNRDNDPSDYVEQDDILIVKLRKGQELRLRAYAKKGFGKEHAKWNPTA
GVAFEYDPDNALRHTVYPKPEEWPKSEYSELDEDESQAPYDPNGKPERFYYNVESCGSLR
PETIVLSALSGLKKKLSDLQTQLSHEIQSDVLTIN

Sequence of entity 5 (D), FASTA

>8RBX_5 RNA polymerase II subunit D (chains D)
MAAGGSDPRAGDVEEDASQLIFPKEFETAETLLNSEVHMLLEHRKQQNESAEDEQELSEV
FMKTLNYTARFSRFKNRETIASVRSLLLQKKLHKFELACLANLCPETAEESKALIPSLEG
RFEDEELQQILDDIQTKRSFQY

Sequence of entity 6 (E), FASTA

>8RBX_6 DNA-directed RNA polymerase II subunit E (chains E)
MDDEEETYRLWKIRKTIMQLCHDRGYLVTQDELDQTLEEFKAQFGDKPSEGRPRRTDLTV
LVAHNDDPTDQMFVFFPEEPKVGIKTIKVYCQRMQEENITRALIVVQQGMTPSAKQSLVD
MAPKYILEQFLQQELLINITEHELVPEHVVMTKEEVTELLARYKLRENQLPRIQAGDPVA
RYFGIKRGQVVKIIRPSETAGRYITYRLVQ

Sequence of entity 7 (F), FASTA

>8RBX_7 DNA-directed RNA polymerases I, II, and III subunit RPABC2 (chains F)
MSDNEDNFDGDDFDDVEEDEGLDDLENAEEEGQENVEILPSGERPQANQKRITTPYMTKY
ERARVLGTRALQIAMCAPVMVELEGETDPLLIAMKELKARKIPIIIRRYLPDGSYEDWGV
DELIISD

Sequence of entity 8 (G), FASTA

>8RBX_8 DNA-directed RNA polymerase II subunit RPB7 (chains G)
MFYHISLEHEILLHPRYFGPNLLNTVKQKLFTEVEGTCTGKYGFVIAVTTIDNIGAGVIQ
PGRGFVLYPVKYKAIVFRPFKGEVVDAVVTQVNKVGLFTEIGPMSCFISRHSIPSEMEFD
PNSNPPCYKTMDEDIVIQQDDEIRLKIVGTRVDKNDIFAIGSLMDDYLGLVS

Sequence of entity 9 (H), FASTA

>8RBX_9 DNA-directed RNA polymerases I, II, and III subunit RPABC3 (chains H)
MAGILFEDIFDVKDIDPEGKKFDRVSRLHCESESFKMDLILDVNIQIYPVDLGDKFRLVI
ASTLYEDGTLDDGEYNPTDDRPSRADQFEYVMYGKVYRIEGDETSTEAATRLSAYVSYGG
LLMRLQGDANNLHGFEVDSRVYLLMKKLAF

Sequence of entity 10 (I), FASTA

>8RBX_10 DNA-directed RNA polymerase II subunit RPB9 (chains I)
MEPDGTYEPGFVGIRFCQECNNMLYPKEDKENRILLYACRNCDYQQEADNSCIYVNKITH
EVDELTQIIADVSQDPTLPRTEDHPCQKCGHKEAVFFQSHSARAEDAMRLYYVCTAPHCG
HRWTE

Sequence of entity 11 (J), FASTA

>8RBX_11 DNA-directed RNA polymerases I, II, and III subunit RPABC5 (chains J)
MIIPVRCFTCGKIVGNKWEAYLGLLQAEYTEGDALDALGLKRYCCRRMLLAHVDLIEKLL
NYAPLEK

Sequence of entity 12 (K), FASTA

>8RBX_12 DNA-directed RNA polymerase II subunit RPB11-a (chains K)
MNAPPAFESFLLFEGEKKITINKDTKVPNACLFTINKEDHTLGNIIKSQLLKDPQVLFAG
YKVPHPLEHKIIIRVQTTPDYSPQEAFTNAITDLISELSLLEERFRVAIKDKQEGIE

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	10
MG	Magnesium ion	Mg	1
MN	Manganese (II) ion	Mn	2

Primary citation

Structural basis of Integrator-dependent RNA polymerase II termination. Fianu, I., Ochmann, M., Walshe, J.L. et al. Nature (2024) 629:219-227. DOI 10.1038/s41586-024-07269-4 · PubMed

Other PDB entries of the same protein (UniProt A0A8D1DPV6), best resolution first:

9HVQ 2.0 Å, Structure of the transcribing Pol II-DSIF-PAF-SPT6-RECQL5 complex
7NVU 2.5 Å, RNA polymerase II core pre-initiation complex with open promoter DNA
8QEP 2.5 Å, RNA polymerase II bound to Alu RNA right arm
8B3D 2.6 Å, Structure of the Pol II-TCR-ELOF1 complex.
7OOB 2.7 Å, Pol II-CSB-CSA-DDB1-UVSSA-ADPBeF3 (Structure2)
8UHG 2.7 Å, Structure of paused transcription complex Pol II-DSIF-NELF - poised post-translocated
8UI0 2.7 Å, Structure of poised transcription complex Pol II-DSIF-NELF - pre-translocated
8WAV 2.72 Å, De novo transcribing complex 12 (TC12), the early elongation complex with Pol II…
8WAX 2.75 Å, De novo transcribing complex 14 (TC14), the early elongation complex with Pol II…
8WAZ 2.76 Å, De novo transcribing complex 16 (TC16), the early elongation complex with Pol II…
7F4G 2.78 Å, Structure of RPAP2-bound RNA polymerase II
8WAU 2.78 Å, De novo transcribing complex 11 (TC11), the early elongation complex with Pol II…

Browse structure collections

About this viewer

MolViewer shows 8RBX directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.