8RGI: DYNLT1:DYNLT2B (TCTEX1:TCTEX1D2) heterodimer

Structure of DYNLT1:DYNLT2B (TCTEX1:TCTEX1D2) heterodimer. Determined by X-ray diffraction at 2.02 Å resolution. Released 20 Mar 2024.

Method: X-ray diffraction
Resolution: 2.02 Å
Organism: Homo sapiens
Chains: 2
Atoms: 1,830
Mol. weight: 28.51 kDa
Released: 20 Mar 2024

Explore 8RGI in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8RGI contains 7 α-helices and 9 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	14-29	16
α-helix	36-38	3
α-helix	39-55	17
β-strand	61-71	11	1
β-strand	77-84	8	2
β-strand	91-98	8	1
β-strand	102-112	11	1

Chain B: 4 helices, 5 β-strands

Element	Residues	Length	Sheet
β-strand	4-11	8	1
α-helix	35-37	3
α-helix	41-56	16
α-helix	63-65	3
α-helix	66-81	16
β-strand	89-99	11	2
β-strand	104-112	9	1
β-strand	119-126	8	2
β-strand	130-140	11	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Dynein light chain Tctex-type 1	A	protein	113	Homo sapiens	P63172 (AlphaFold model)
Dynein light chain Tctex-type protein 2B	B	protein	142	Homo sapiens	Q8WW35 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>8RGI_1 Dynein light chain Tctex-type 1 (chains A)
SEDYQAAEETAFVVDEVSNIVKEAIESAIGGNAYQHSKVNQWTTNVVEQTLSQLTKLGKP
FKYIVTCVIMQKNGAGLHTASSCFWDSSTDGSCTVRWENKTMYCIVSAFGLSI

Sequence of entity 2 (B), FASTA

>8RGI_2 Dynein light chain Tctex-type protein 2B (chains B)
SATSIGVSFSVGDGVPEAEKNAGEPENTYILRPVFQQRFRPSVVKDCIHAVLKEELANAE
YSPEEMPQLTKHLSENIKDKLKEMGFDRYKMVVQVVIGEQRGEGVFMASRCFWDADTDNY
THDVFMNDSLFCVVAAFGCFYY

Primary citation

Structure and tethering mechanism of dynein-2 intermediate chains in intraflagellar transport. Mukhopadhyay, A.G., Toropova, K., Daly, L. et al. EMBO J (2024) 43:1257-1272. DOI 10.1038/s44318-024-00060-1 · PubMed

Other PDB entries of the same protein (UniProt P63172 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9BLY 3.5 Å, Composite structure of full-length human dynein-1 in phi-particle conformation
8J07 4.1 Å, 96nm repeat of human respiratory doublet microtubule and associated axonemal complexes
9E28 4.4 Å, Cryo-EM structure of Phi dynein tail
9E12 4.5 Å, Full-length human dynein-1 in phi comformation under Lis1 condition
9E13 4.5 Å, Full-length human dynein-1 in phi-like comformation bound to a Lis1 dimer under Lis1…
9E14 5.0 Å, Full-length human dynein-1 in phi-like comformation bound to a Lis1 dimer under…
9YNH 5.5 Å, Full-length human cytoplasmic dynein-1 in phi-like state bound to dynactin-p150glued and…
9E23 6.2 Å, Cryo-EM structure of Pre-Chi dynein tail
8PR1 8.2 Å, Cytoplasmic dynein-B heavy chain bound to IC-LC tower
9YNE 8.46 Å, Motor domain of human dynein-1 in pre-power stroke bound to dynactin-p150glued-CC1B-ICD…
8PR0 9.4 Å, Cytoplasmic dynein-A heavy chain bound to dynactin-p150glued and IC-LC tower
8PTK 10.0 Å, Composite structure of Dynein-Dynactin-JIP3-LIS1

Browse structure collections

About this viewer

MolViewer shows 8RGI directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.