TUBB4B and TUBA1A Heterodimer from Human Respiratory Doublet Microtubules. Determined by electron microscopy at 2.8 Å resolution. Released 1 May 2024.
Explore 8SH7 in 3D Show helices and sheets RCSB PDB PDBe
8SH7 contains 54 α-helices and 36 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 4-9 | 6 | 1 |
| α-helix | 10-28 | 19 | |
| β-strand | 35 | 1 | 2 |
| α-helix | 48-51 | 4 | |
| β-strand | 53-55 | 3 | 3 |
| β-strand | 60 | 1 | 2 |
| β-strand | 61-63 | 3 | 3 |
| β-strand | 65-69 | 5 | 1 |
| α-helix | 72-78 | 7 | |
| α-helix | 89-91 | 3 | |
| β-strand | 92-94 | 3 | 1 |
| α-helix | 103-104 | 2 | |
| α-helix | 105-109 | 5 | |
| α-helix | 111-128 | 18 | |
| β-strand | 134-140 | 7 | 1 |
| α-helix | 144 | 1 | |
| α-helix | 145-149 | 5 | |
| α-helix | 150-160 | 11 | |
| β-strand | 165-171 | 7 | 1 |
| α-helix | 172-174 | 3 | |
| α-helix | 183-196 | 14 | |
| β-strand | 200-204 | 5 | 1 |
| α-helix | 206-215 | 10 | |
| α-helix | 224-238 | 15 | |
| α-helix | 240-243 | 4 | |
| β-strand | 248 | 1 | 4 |
| α-helix | 252-257 | 6 | |
| α-helix | 268 | 1 | |
| β-strand | 269-273 | 5 | 4 |
| β-strand | 277 | 1 | 5 |
| α-helix | 278-281 | 4 | |
| α-helix | 288-295 | 8 | |
| α-helix | 298-300 | 3 | |
| α-helix | 307-309 | 3 | |
| β-strand | 312-321 | 10 | 4 |
| α-helix | 325-337 | 13 | |
| β-strand | 343 | 1 | 4 |
| β-strand | 351-356 | 6 | 4 |
| α-helix | 359-361 | 3 | |
| β-strand | 368 | 1 | 5 |
| α-helix | 369-370 | 2 | |
| β-strand | 373-381 | 9 | 4 |
| α-helix | 382-384 | 3 | |
| α-helix | 385-399 | 15 | |
| α-helix | 405-409 | 5 | |
| α-helix | 416-435 | 20 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 3-9 | 7 | 6 |
| α-helix | 10-28 | 19 | |
| β-strand | 30 | 1 | 7 |
| β-strand | 35 | 1 | 8 |
| β-strand | 36 | 1 | 7 |
| α-helix | 41-43 | 3 | |
| α-helix | 47-49 | 3 | |
| β-strand | 51-54 | 4 | 8 |
| β-strand | 58-61 | 4 | 8 |
| β-strand | 63-67 | 5 | 6 |
| α-helix | 71-77 | 7 | |
| α-helix | 81-83 | 3 | |
| α-helix | 87-89 | 3 | |
| β-strand | 90-92 | 3 | 6 |
| α-helix | 101-102 | 2 | |
| α-helix | 103-107 | 5 | |
| α-helix | 109-124 | 16 | |
| β-strand | 130-138 | 9 | 6 |
| α-helix | 143-147 | 5 | |
| α-helix | 148-158 | 11 | |
| β-strand | 163-169 | 7 | 6 |
| α-helix | 181-195 | 15 | |
| β-strand | 198-202 | 5 | 6 |
| α-helix | 204-213 | 10 | |
| α-helix | 222-241 | 20 | |
| β-strand | 244-246 | 3 | 9 |
| α-helix | 250-257 | 8 | |
| β-strand | 265-266 | 2 | 6 |
| β-strand | 267-271 | 5 | 9 |
| α-helix | 278-281 | 4 | |
| α-helix | 286-294 | 9 | |
| α-helix | 296-298 | 3 | |
| α-helix | 305-307 | 3 | |
| β-strand | 310-318 | 9 | 9 |
| α-helix | 323-336 | 14 | |
| α-helix | 338-340 | 3 | |
| β-strand | 341 | 1 | 9 |
| β-strand | 349-354 | 6 | 9 |
| α-helix | 357-358 | 2 | |
| β-strand | 364-371 | 8 | 9 |
| α-helix | 372-374 | 3 | |
| α-helix | 375-389 | 15 | |
| α-helix | 395-399 | 5 | |
| α-helix | 406-423 | 18 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Tubulin alpha-1A chain | A | protein | 451 | Homo sapiens | Q71U36 (AlphaFold model) |
| Tubulin beta-4B chain | B | protein | 445 | Homo sapiens | P68371 (AlphaFold model) |
>8SH7_1 Tubulin alpha-1A chain (chains A) MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGK HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDLVLD RIRKLADQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTA VVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITA SLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPAN QMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPP TVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSE AREDMAALEKDYEEVGVDSVEGEGEEEGEEY
>8SH7_2 Tubulin beta-4B chain (chains B) MREIVHLQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDLQLERINVYYNEATGGKYV PRAVLVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVV RKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVV EPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCL RFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMM AACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRG LKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVS EYQQYQDATAEEEGEFEEEAEEEVA
| ID | Name | Formula | Copies |
|---|---|---|---|
| GDP | Guanosine-5'-diphosphate | C10 H15 N5 O11 P2 | 1 |
| MG | Magnesium ion | Mg | 1 |
| GTP | Guanosine-5'-triphosphate | C10 H16 N5 O14 P3 | 1 |
Ciliopathy patient variants reveal organelle-specific functions for TUBB4B in axonemal microtubules. Dodd, D.O., Mechaussier, S., Yeyati, P.L. et al. Science (2024) 384:eadf5489-eadf5489. DOI 10.1126/science.adf5489 · PubMed
Other PDB entries of the same protein (UniProt Q71U36 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 8SH7 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.