9WD9: Tubulin alpha-1A chain

GMPCPP-stabilized human alpha1A/beta3 S239C microtubule. Determined by electron microscopy at 2.26 Å resolution. Released 1 Apr 2026.

Method: Electron microscopy
Resolution: 2.26 Å
Organism: Homo sapiens
Chains: 2
Atoms: 6,814
Mol. weight: 101.78 kDa
Ligands: G2P, MG, GTP
Released: 1 Apr 2026

Explore 9WD9 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9WD9 contains 56 α-helices and 33 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain a: 27 helices, 15 β-strands

Element	Residues	Length	Sheet
β-strand	4-9	6	1
α-helix	10-27	18
β-strand	35	1	2
α-helix	48-51	4
β-strand	53-56	4	2
β-strand	60-63	4	2
β-strand	65-69	5	1
α-helix	73-78	6
α-helix	89-91	3
β-strand	92-94	3	1
α-helix	103-104	2
α-helix	105-109	5
α-helix	111-113	3
α-helix	115-127	13
β-strand	134-140	7	1
α-helix	145-149	5
α-helix	150-160	11
β-strand	165-171	7	1
α-helix	172-174	3
α-helix	183-189	7
α-helix	191-196	6
β-strand	200-204	5	1
α-helix	206-215	10
α-helix	224-239	16
α-helix	240-242	3
β-strand	248	1	3
α-helix	252-257	6
β-strand	269-273	5	3
α-helix	278-281	4
α-helix	288-294	7
α-helix	307-309	3
β-strand	312-321	10	3
α-helix	325-335	11
β-strand	343	1	3
β-strand	351-356	6	3
α-helix	358-363	6
α-helix	368-370	3
β-strand	373-381	9	3
α-helix	382-384	3
α-helix	385-400	16
α-helix	405-409	5
α-helix	416-434	19

Chain b: 29 helices, 18 β-strands

Element	Residues	Length	Sheet
β-strand	3-9	7	4
α-helix	10-27	18
β-strand	30	1	5
β-strand	36	1	5
α-helix	41-44	4
α-helix	47-49	3
β-strand	51-54	4	6
β-strand	58-61	4	6
β-strand	63-67	5	4
α-helix	71-77	7
α-helix	82-84	3
α-helix	87-89	3
β-strand	90-92	3	4
α-helix	101-102	2
α-helix	103-107	5
α-helix	108-125	18
β-strand	130-138	9	4
α-helix	143-147	5
α-helix	148-158	11
β-strand	163-169	7	4
α-helix	170-171	2
α-helix	181-195	15
β-strand	198-202	5	4
α-helix	204-209	6
α-helix	210-214	5
α-helix	222-236	15
α-helix	238-241	4
β-strand	246	1	7
α-helix	250-257	8
β-strand	265-266	2	4
β-strand	267-271	5	7
α-helix	279-281	3
α-helix	286-293	8
α-helix	296-298	3
β-strand	299	1	7
α-helix	305-307	3
β-strand	310-318	9	7
α-helix	323-336	14
α-helix	338-340	3
β-strand	341	1	7
β-strand	349-354	6	7
α-helix	356-358	3
β-strand	364-371	8	7
α-helix	372-374	3
α-helix	375-389	15
α-helix	395-399	5
α-helix	405-424	20

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Tubulin alpha-1A chain	a	protein	451	Homo sapiens	Q71U36 (AlphaFold model)
Tubulin beta-3 chain	b	protein	450	Homo sapiens	Q13509 (AlphaFold model)

Sequence of entity 1 (a), FASTA

>9WD9_1 Tubulin alpha-1A chain (chains a)
MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGK
HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDLVLD
RIRKLADQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTA
VVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITA
SLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPAN
QMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPP
TVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSE
AREDMAALEKDYEEVGVDSVEGEGEEEGEEY

Sequence of entity 2 (b), FASTA

>9WD9_2 Tubulin beta-3 chain (chains b)
MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPSGNYVGDSDLQLERISVYYNEASSHKYV
PRAILVDLEPGTMDSVRSGAFGHLFRPDNFIFGQSGAGNNWAKGHYTEGAELVDSVLDVV
RKECENCDCLQGFQLTHSLGGGTGSGMGTLLISKVREEYPDRIMNTFSVVPSPKVSDTVV
EPYNATLSIHQLVENTDETYCIDNEALYDICFRTLKLATPTYGDLNHLVSATMSGVTTCL
RFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTARGSQQYRALTVPELTQQMFDAKNMM
AACDPRHGRYLTVATVFRGRMSMKEVDEQMLAIQSKNSSYFVEWIPNNVKVAVCDIPPRG
LKMSSTFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVS
EYQQYQDATAEEEGEMYEDDEEESEAQGPK

Ligands and cofactors

ID	Name	Formula	Copies
G2P	Phosphomethylphosphonic acid guanylate ester	C11 H18 N5 O13 P3	1
MG	Magnesium ion	Mg	2
GTP	Guanosine-5'-triphosphate	C10 H16 N5 O14 P3	1

Primary citation

An evolution-conserved allosteric network in human tubulin governs paclitaxel efficacy. Luo, J., Khoo, C.J., Chen, W. et al. Nat Chem Biol (2026). DOI 10.1038/s41589-026-02204-2 · PubMed

Other PDB entries of the same protein (UniProt Q71U36 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6J8F 2.28 Å, Crystal structure of SVBP-VASH1 with peptide mimic the C-terminal of alpha-tubulin
9WD7 2.34 Å, GMPCPP-stabilizsd human alpha1A/beta3 microtubule
9WDA 2.35 Å, Paclitaxel/GMPCPP-stabilized human alpha1A/beta3 microtubule
9WDB 2.39 Å, Paclitaxel/GMPCPP-stabilized human alpha1A/beta3 S239C microtubule
22AK 2.41 Å, GDP human alpha1A/beta3 microtubule
22AJ 2.48 Å, GDP human alpha1A/beta3 S239C microtubule
9OX7 2.69 Å, In situ microtubule structure in the axon of a human neuron
8SH7 2.8 Å, TUBB4B and TUBA1A Heterodimer from Human Respiratory Doublet Microtubules
6WSL 3.1 Å, Cryo-EM structure of VASH1-SVBP bound to microtubules
7UNG 3.6 Å, 48-nm repeat of the human respiratory doublet microtubule
5JCO 4.0 Å, Structure and dynamics of single-isoform recombinant neuronal human tubulin
8J07 4.1 Å, 96nm repeat of human respiratory doublet microtubule and associated axonemal complexes

Browse structure collections

About this viewer

MolViewer shows 9WD9 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.