8T5F: Parathyroid hormone

De novo design of high-affinity protein binders to bioactive helical peptides. Determined by X-ray diffraction at 1.99 Å resolution. Released 10 Jan 2024.

Method: X-ray diffraction
Resolution: 1.99 Å
Organism: Homo sapiens
Chains: 3
Atoms: 879
Mol. weight: 12.38 kDa
Released: 10 Jan 2024

Explore 8T5F in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8T5F contains 3 α-helices and 0 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	148-177	30

Chain B: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	148-176	29

Chain C: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	146-176	31

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Parathyroid hormone	A, B, C	protein	34	Homo sapiens	P01270 (AlphaFold model)

Sequence of entity 1 (A, B, C), FASTA

>8T5F_1 Parathyroid hormone (chains A, B, C)
SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF

Primary citation

De novo design of high-affinity binders of bioactive helical peptides. Vazquez Torres, S., Leung, P.J.Y., Venkatesh, P. et al. Nature (2024) 626:435-442. DOI 10.1038/s41586-023-06953-1 · PubMed

Other PDB entries of the same protein (UniProt P01270 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1ET1 0.9 Å, Crystal structure of human parathyroid hormone 1-34 at 0.9 a resolution
3C4M 1.95 Å, Structure of human parathyroid hormone in complex with the extracellular domain of its…
8FLQ 2.55 Å, Human PTH1R in complex with PTH(1-34) and Gs
8HA0 2.62 Å, Molecular recognition of two endogenous hormones by the human parathyroid hormone…
7VVL 2.8 Å, PTH-bound human PTH1R in complex with Gs (class2)
7Y36 2.8 Å, Cryo-EM structure of the Teriparatide-bound human PTH1R-Gs complex
9JR2 2.8 Å, Cryo-EM structure of PTH-PTH1R-Gq (upright state)
9JR3 2.8 Å, Cryo-EM structure of PTH-PTH1R-Gq (tilted state)
7VVM 3.2 Å, PTH-bound human PTH1R in complex with Gs (class3)
7VVK 3.3 Å, PTH-bound human PTH1R in complex with Gs (class1)
8HAO 3.76 Å, Human parathyroid hormone receptor-1 dimer
7VVN 3.8 Å, PTH-bound human PTH1R in complex with Gs (class4)

Browse structure collections

About this viewer

MolViewer shows 8T5F directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.