8T7H: Quis-bound intermediate mGlu5

Quis-bound intermediate mGlu5. Determined by electron microscopy at 3.3 Å resolution. Released 11 Oct 2023.

Method: Electron microscopy
Resolution: 3.3 Å
Organisms: Homo sapiens, Lama glama
Chains: 4
Atoms: 13,100
Mol. weight: 224.82 kDa
Ligands: QUS
Released: 11 Oct 2023

Explore 8T7H in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8T7H contains 68 α-helices and 87 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 31 helices, 32 β-strands

Element	Residues	Length	Sheet
β-strand	28-31	4	1
β-strand	35	1	2
β-strand	36	1	3
β-strand	38-41	4	1
β-strand	44	1	4
α-helix	46-48	3
α-helix	52-54	3
β-strand	60	1	4
α-helix	62-66	5
α-helix	67-81	15
β-strand	91	1	2
β-strand	93-97	5	1
α-helix	102-115	14
α-helix	118-121	4
α-helix	141-142	2
β-strand	143	1	3
β-strand	146	1	5
α-helix	154-162	9
β-strand	169-171	3	5
β-strand	188-190	3	5
α-helix	198-208	11
β-strand	215-217	3	6
β-strand	219	1	7
α-helix	224-236	13
β-strand	248	1	7
α-helix	255-265	11
β-strand	273-276	4	6
α-helix	280-293	14
β-strand	300-303	4	6
α-helix	305-307	3
β-strand	325-329	5	6
α-helix	335-341	7
α-helix	346-348	3
α-helix	356-363	8
α-helix	397-418	22
α-helix	427-429	3
α-helix	434-441	8
β-strand	446-447	2	8
β-strand	453-454	2	8
β-strand	466-475	10	6
β-strand	478-483	6	6
β-strand	487	1	6
α-helix	507-508	2
β-strand	521-523	3	9
β-strand	533-535	3	9
β-strand	541-543	3	10
β-strand	549-551	3	10
α-helix	552-553	2
β-strand	556-558	3	11
β-strand	565-567	3	11
α-helix	568-569	2
β-strand	570-571	2	12
α-helix	578-603	26
α-helix	608-612	5
α-helix	615-632	18
α-helix	643-672	30
α-helix	690-714	25
β-strand	719-722	4	12
β-strand	729-733	5	12
α-helix	737-760	24
α-helix	766-788	23
α-helix	790-793	4
α-helix	798-826	29

Chain B: 31 helices, 31 β-strands

Element	Residues	Length	Sheet
β-strand	28-31	4	13
β-strand	35-41	7	13
β-strand	44	1	14
α-helix	46-48	3
α-helix	52-54	3
β-strand	60	1	14
α-helix	62-66	5
α-helix	67-81	15
β-strand	91-97	7	13
α-helix	102-114	13
α-helix	115-120	6
α-helix	141-142	2
β-strand	143	1	13
β-strand	146	1	15
α-helix	154-162	9
β-strand	169-171	3	15
α-helix	178-180	3
β-strand	188-190	3	15
α-helix	198-208	11
β-strand	213-214	2	16
β-strand	215-217	3	17
β-strand	219	1	18
α-helix	224-236	13
β-strand	241-242	2	16
β-strand	248	1	18
α-helix	255-265	11
β-strand	273-276	4	17
α-helix	280-293	14
β-strand	300-303	4	17
α-helix	305-307	3
β-strand	325-329	5	17
α-helix	335-341	7
α-helix	346-348	3
α-helix	356-363	8
α-helix	397-418	22
α-helix	427-429	3
α-helix	434-441	8
β-strand	446-447	2	19
β-strand	453-454	2	19
β-strand	466-472	7	17
β-strand	480-483	4	17
β-strand	487	1	17
α-helix	507-508	2
β-strand	521-523	3	20
β-strand	533-535	3	20
β-strand	541-543	3	21
β-strand	549-551	3	21
α-helix	552-553	2
β-strand	556-558	3	22
β-strand	565-567	3	22
α-helix	568-569	2
β-strand	570-571	2	23
α-helix	578-603	26
α-helix	608-612	5
α-helix	615-632	18
α-helix	643-672	30
α-helix	690-714	25
β-strand	719-722	4	23
β-strand	729-733	5	23
α-helix	737-760	24
α-helix	766-788	23
α-helix	798-826	29

Chain C: 3 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	6-9	4	24
β-strand	13-14	2	25
β-strand	19-26	8	24
α-helix	31-33	3
β-strand	35-41	7	26
β-strand	48-53	6	26
β-strand	60-62	3	26
α-helix	64-66	3
β-strand	71-75	5	24
β-strand	80-86	7	24
α-helix	90-92	3
β-strand	94-101	8	26
β-strand	114	1	26
β-strand	119-121	3	26
β-strand	122-123	2	25

Chain D: 3 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	6-9	4	27
β-strand	13-14	2	28
β-strand	20-26	7	27
α-helix	31-33	3
β-strand	35-41	7	29
β-strand	48-53	6	29
β-strand	60-62	3	29
α-helix	64-66	3
β-strand	70-75	6	27
β-strand	80-85	6	27
α-helix	90-92	3
β-strand	94-101	8	29
β-strand	114	1	29
β-strand	119-121	3	29
β-strand	122-123	2	28

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Metabotropic glutamate receptor 5	A, B	protein	881	Homo sapiens	P41594 (AlphaFold model)
Nanobody 43	C, D	protein	123	Lama glama

Sequence of entity 1 (A, B), FASTA

>8T7H_1 Metabotropic glutamate receptor 5 (chains A, B)
MKTIIALSYIFCLVFADYKDDDDAAQSSERRVVAHMPGDIIIGALFSVHHQPTVDKVHER
KCGAVREQYGIQRVEAMLHTLERINSDPTLLPNITLGCEIRDSCWHSAVALEQSIEFIRD
SLISSEEEEGLVRCVDGSSSSFRSKKPIVGVIGPGSSSVAIQVQNLLQLFNIPQIAYSAT
SMDLSDKTLFKYFMRVVPSDAQQARAMVDIVKRYNWTYVSAVHTEGNYGESGMEAFKDMS
AKEGICIAHSYKIYSNAGEQSFDKLLKKLTSHLPKARVVACFCEGMTVRGLLMAMRRLGL
AGEFLLLGSDGWADRYDVTDGYQREAVGGITIKLQSPDVKWFDDYYLKLRPETNHRNPWF
QEFWQHRFQCRLEGFPQENSKYNKTCNSSLTLKTHHVQDSKMGFVINAIYSMAYGLHNMQ
MSLCPGYAGLCDAMKPIDGRKLLESLMKTNFTGVSGDTILFDENGDSPGRYEIMNFKEMG
KDYFDYINVGSWDNGELKMDDDEVWSKKSNIIRSVCSEPCEKGQIKVIRKGEVSCCWTCT
PCKENEYVFDEYTCKACQLGSWPTDDLTGCDLIPVQYLRWGDPEPIAAVVFACLGLLATL
FVTVVFIIYRDTPVVKSSSRELCYIILAGICLGYLCTFCLIAKPKQIYCYLQRIGIGLSP
AMSYSALVTKTNRIARILAGSKKKICTKKPRFMSACAQLVIAFILICIQLGIIVALFIME
PPDIMHDYPSIREVYLICNTTNLGVVTPLGYNGLLILSCTFYAFKTRNVPANFNEAKYIA
FTMYTTCIIWLAFVPIYFGSNYKIITMCFSVSLSATVALGCMFVPKVYIILAKPERNVRS
AFTTSTVVRMHVGDGKSSSAASRSSSLVNLWKRRGSSGETL

Sequence of entity 2 (C, D), FASTA

>8T7H_2 Nanobody 43 (chains C, D)
QVQLVESGGGLVQAGGSLRLSCAASGRTFTSYAMGWFRQAPGKERESVAAISSSGGSTHY
ADSVKGRFTISRDNSKNTVYLQMNSLKPEDTAVYYCAAAMYGSRWPDWEYDYWGQGTQVT
VSS

Ligands and cofactors

ID	Name	Formula	Copies
QUS	(s)-2-amino-3-(3,5-dioxo-[1,2,4]OXADIAZOLIDIN-2-yl)-propionic acid	C5 H7 N3 O5	2

Primary citation

Stepwise activation of a metabotropic glutamate receptor. Krishna Kumar, K., Wang, H., Habrian, C. et al. Nature (2024) 629:951-956. DOI 10.1038/s41586-024-07327-x · PubMed

Other PDB entries of the same protein (UniProt P41594 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6FFI 2.2 Å, Crystal Structure of mGluR5 in complex with MMPEP at 2.2 A
9HC0 2.33 Å, Dark structure of the human metabotropic glutamate receptor 5 transmembrane domain bound…
3LMK 2.44 Å, Ligand Binding Domain of Metabotropoc glutamate receptor mGluR5 complexed with glutamate
7P2L 2.54 Å, thermostabilised 7TM domain of human mGlu5 receptor bound to photoswitchable ligand…
4OO9 2.6 Å, Structure of the human class C GPCR metabotropic glutamate receptor 5 transmembrane…
5CGD 2.6 Å, Structure of the human class C GPCR metabotropic glutamate receptor 5 transmembrane…
6FFH 2.65 Å, Crystal Structure of mGluR5 in complex with Fenobam at 2.65 A
8TAO 2.9 Å, Quis and CDPPB bound active mGlu5
9HC3 2.9 Å, Apo-state structure of the human metabotropic glutamate receptor 5 transmembrane domain…
8T8M 3.0 Å, Quis-bound intermediate mGlu5
8X0G 3.0 Å, Human FL Metabotropic glutamate receptor 5, mGlu5-5M with quisqualate, Acc conformation…
8X0B 3.1 Å, Human FL Metabotropic glutamate receptor 5, mGlu5-5M with Quisqualate and VU0424465

Browse structure collections

About this viewer

MolViewer shows 8T7H directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.