Structure of SNX27 FERM complexed with Fam21A repeat 15 (1124-1140). Determined by X-ray diffraction at 2.35 Å resolution. Released 21 Aug 2024.
Explore 8TTT in 3D Show helices and sheets RCSB PDB PDBe
8TTT contains 12 α-helices and 16 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 274-280 | 7 | 1 |
| β-strand | 286-292 | 7 | 1 |
| α-helix | 297-307 | 11 | |
| α-helix | 314-317 | 4 | |
| β-strand | 318-325 | 8 | 1 |
| β-strand | 328-331 | 4 | 1 |
| α-helix | 332-333 | 2 | |
| α-helix | 338-344 | 7 | |
| β-strand | 355-359 | 5 | 1 |
| α-helix | 364-368 | 5 | |
| α-helix | 374-390 | 17 | |
| β-strand | 394 | 1 | 2 |
| α-helix | 396-398 | 3 | |
| α-helix | 399-407 | 9 | |
| α-helix | 411-418 | 8 | |
| β-strand | 422 | 1 | 2 |
| β-strand | 427-428 | 2 | 3 |
| α-helix | 429-431 | 3 | |
| β-strand | 432 | 1 | 3 |
| β-strand | 434 | 1 | 4 |
| β-strand | 441-446 | 6 | 3 |
| β-strand | 451-456 | 6 | 3 |
| β-strand | 462-469 | 8 | 3 |
| α-helix | 471-473 | 3 | |
| β-strand | 474-480 | 7 | 4 |
| β-strand | 485-490 | 6 | 4 |
| β-strand | 498-502 | 5 | 4 |
| α-helix | 507-522 | 16 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Sorting nexin-27 | A | protein | 261 | Homo sapiens | Q96L92 (AlphaFold model) |
| Fam21A repeat 15 peptide | B | protein | 17 | Homo sapiens | Q641Q2 (AlphaFold model) |
>8TTT_1 Sorting nexin-27 (chains A) SNAGVSDVELRVALPDGTTVTVRVKKNSTTDQVYQAIAAKVGMDSTTVNYFALFEVISHS FVRKLAPNEFPHKLYIQNYTSAVPGTCLTIRKWLFTTEEEILLNDNDLAVTYFFHQAVDD VKKGYIKAEEKSYQLQKLYEQRKMVMYLNMLRTCEGYNEIIFPHCACDSRRKGHVITAIS ITHFKLHACTEEGQLENQVIAFEWDEMQRWDTDEEGMAFCFEYARGEKKPRWVKIFTPYF NYMHECFERVFCELKWRKEEY
>8TTT_2 Fam21A repeat 15 peptide (chains B) RGEADLFDSGDIFSTGT
Structural basis for coupling of the WASH subunit FAM21 with the endosomal SNX27-Retromer complex. Guo, Q., Chen, K.E., Gimenez-Andres, M. et al. Proc Natl Acad Sci U S A (2024) 121:e2405041121-e2405041121. DOI 10.1073/pnas.2405041121 · PubMed
Other PDB entries of the same protein (UniProt Q96L92 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 8TTT directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.