8TUA: Full-length P-Rex1

Full-length P-Rex1 in complex with inositol 1,3,4,5-tetrakisphosphate (IP4). Determined by electron microscopy at 4.1 Å resolution. Released 10 Apr 2024.

Method: Electron microscopy
Resolution: 4.1 Å
Organism: Homo sapiens
Chains: 1
Atoms: 10,685
Mol. weight: 183.96 kDa
Ligands: 4IP
Released: 10 Apr 2024

Explore 8TUA in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8TUA contains 50 α-helices and 64 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 50 helices, 64 β-strands

Element	Residues	Length	Sheet
α-helix	39-74	36
α-helix	93-100	8
α-helix	103-120	18
α-helix	132-137	6
α-helix	140-143	4
α-helix	144-164	21
α-helix	166-179	14
α-helix	188-212	25
α-helix	220-236	17
α-helix	239-255	17
β-strand	257-258	2	1
β-strand	272-275	4	2
β-strand	278	1	3
β-strand	281-282	2	4
β-strand	285-286	2	4
β-strand	289	1	3
β-strand	290-294	5	2
β-strand	297-301	5	2
β-strand	325-326	2	1
β-strand	327-331	5	2
α-helix	333-335	3
β-strand	336-340	5	5
β-strand	358-363	6	5
β-strand	368-373	6	5
α-helix	377-421	45
β-strand	429-431	3	6
β-strand	438-441	4	6
β-strand	442-443	2	7
α-helix	444-453	10
α-helix	460-472	13
β-strand	476-478	3	7
β-strand	491-494	4	7
α-helix	510-523	14
β-strand	530-534	5	8
β-strand	537-544	8	8
α-helix	545-554	10
α-helix	561-573	13
β-strand	577-579	3	8
β-strand	592-595	4	8
α-helix	596-601	6
β-strand	616	1	9
β-strand	620	1	10
β-strand	623	1	11
β-strand	627-628	2	12
β-strand	637	1	13
β-strand	640-642	3	14
β-strand	645-647	3	14
β-strand	651	1	13
α-helix	656-660	5
β-strand	667	1	14
β-strand	668	1	15
β-strand	670	1	16
β-strand	675	1	16
α-helix	681-694	14
β-strand	698-699	2	12
β-strand	702	1	15
β-strand	708-713	6	17
β-strand	723-724	2	17
β-strand	730-731	2	17
α-helix	739-743	5
β-strand	750-754	5	17
β-strand	758	1	17
α-helix	764-770	7
α-helix	772-776	5
β-strand	789	1	18
α-helix	792-802	11
β-strand	841-847	7	17
β-strand	852	1	11
β-strand	855	1	10
β-strand	858	1	9
β-strand	859-860	2	19
β-strand	866-867	2	19
β-strand	873-874	2	20
α-helix	880-906	27
α-helix	916-946	31
β-strand	953	1	21
α-helix	954-956	3
α-helix	964-967	4
β-strand	970	1	21
β-strand	973-975	3	20
β-strand	1022-1025	4	20
α-helix	1071-1107	37
α-helix	1212-1237	26
α-helix	1239-1247	9
α-helix	1248-1250	3
α-helix	1257-1280	24
α-helix	1282-1284	3
α-helix	1285-1313	29
α-helix	1317-1346	30
α-helix	1360-1373	14
β-strand	1377-1380	4	22
α-helix	1390-1406	17
β-strand	1410	1	23
β-strand	1411	1	24
β-strand	1421	1	18
β-strand	1427	1	25
β-strand	1438	1	23
β-strand	1442	1	25
α-helix	1446-1449	4
α-helix	1454-1457	4
β-strand	1461	1	24
β-strand	1464-1467	4	22
α-helix	1474-1475	2
α-helix	1482-1514	33
α-helix	1533-1550	18
α-helix	1564-1574	11
α-helix	1577	1
β-strand	1578-1580	3	22
β-strand	1581-1582	2	20
α-helix	1588-1605	18
α-helix	1610-1612	3
α-helix	1613-1622	10
α-helix	1625-1627	3
α-helix	1628-1631	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Phosphatidylinositol 3,4,5-trisphosphate-dependent Rac exchanger 1 protein	A	protein	1625	Homo sapiens	Q8TCU6 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>8TUA_1 Phosphatidylinositol 3,4,5-trisphosphate-dependent Rac exchanger 1 protein (chains A)
GEFAAARESERQLRLRLCVLNEILGTERDYVGTLRFLQSAFLHRIRQNVADSVEKGLTEE
NVKVLFSNIEDILEVHKDFLAALEYCLHPEPQSQHELGNVFLKFKDKFCVYEEYCSNHEK
ALRLLVELNKIPTVRAFLLSCMLLGGRKTTDIPLEGYLLSPIQRICKYPLLLKELAKRTP
GKHPDHPAVQSALQAMKTVCSNINETKRQMEKLEALEQLQSHIEGWEGSNLTDICTQLLL
QGTLLKISAGNIQERAFFLFDNLLVYCKRKSRVTGSKKSTKRTKSINGSLYIFRGRINTE
VMEVENVEDGTADYHSNGYTVTNGWKIHNTAKNKWFVCMAKTAEEKQKWLDAIIREREQR
ESLKLGMERDAYVMIAEKGEKLYHMMMNKKVNLIKDRRRKLSTVPKCFLGNEFVAWLLEI
GEISKTEEGVNLGQALLENGIIHHVSDKHQFKNEQVMYRFRYDDGTYKARSELEDIMSKG
VRLYCRLHSLYTPVIKDRDYHLKTYKSVLPGSKLVDWLLAQGDCQTREEAVALGVGLCNN
GFMHHVLEKSEFRDESQYFRFHADEEMEGTSSKNKQLRNDFKLVENILAKRLLILPQEED
YGFDIEEKNKAVVVKSVQRGSLAEVAGLQVGRKIYSINEDLVFLRPFSEVESILNQSFCS
RRPLRLLVATKAKEIIKIPDQPDTLCFQIRGAAPPYVYAVGRGSEAMAAGLCAGQCILKV
NGSNVMNDGAPEVLEHFQAFRSRREEALGLYQWIYHTHEDAQEARASQEASTEDPSGEQA
QEEDQADSAFPLLSLGPRLSLCEDSPMVTLTVDNVHLEHGVVYEYVSTAGVRCHVLEKIV
EPRGCFGLTAKILEAFAANDSVFVENCRRLMALSSAIVTMPHFEFRNICDTKLESIGQRI
ACYQEFAAQLKSRVSPPFKQAPLEPHPLCGLDFCPTNCHINLMEVSYPKTTPSVGRSFSI
RFGRKPSLIGLDPEQGHLNPMSYTQHCITTMAAPSWKCLPAAEGDPQGQGLHDGSFGPAS
GTLGQEDRGLSFLLKQEDREIQDAYLQLFTKLDVALKEMKQYVTQINRLLSTITEPTSGG
SCDASLAEEASSLPLVSEESEMDRSDHGGIKKVCFKVAEEDQEDSGHDTMSYRDSYSECN
SNRDSVLSYTSVRSNSSYLGSDEMGSGDELPCDMRIPSDKQDKLHGCLEHLFNQVDSINA
LLKGPVMSRAFEETKHFPMNHSLQEFKQKEECTIRGRSLIQISIQEDPWNLPNSIKTLVD
NIQRYVEDGKNQLLLALLKCTDTELQLRRDAIFCQALVAAVCTFSEQLLAALGYRYNNNG
EYEESSRDASRKWLEQVAATGVLLHCQSLLSPATVKEERTMLEDIWVTLSELDNVTFSFK
QLDENYVANTNVFYHIEGSRQALKVIFYLDSYHFSKLPSRLEGGASLRLHTALFTKVLEN
VEGLPSPGSQAAEDLQQDINAQSLEKVQQYYRKLRAFYLERSNLPTDASTTAVKIDQLIR
PINALDELCRLMKSFVHPKPGAAGSVGAGLIPISSELCYRLGACQMVMCGTGMQRSTLSV
SLEQAAILARSHGLLPKCIMQATDIMRKQGPRVEILAKNLRVKDQMPQGAPRLYRLCQPP
VDGDL

Ligands and cofactors

ID	Name	Formula	Copies
4IP	Inositol-(1,3,4,5)-tetrakisphosphate	C6 H16 O18 P4	1

Primary citation

Full-length P-Rex1 in complex with inositol 1,3,4,5-tetrakisphosphate (IP4). Ravala, S.K., Adame-Garcia, S.R., Li, S. et al. Elife (2024). DOI 10.7554/eLife.92822.1

Other PDB entries of the same protein (UniProt Q8TCU6 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5D3X 1.69 Å, Crystal Structure of the P-Rex1 PH domain with Inositol-(1,3,4,5)-Tetrakisphosphate Bound
5D3V 1.85 Å, Crystal Structure of the P-Rex1 PH domain with Citrate Bound
5D3W 1.85 Å, Crystal Structure of the P-Rex1 PH domain with Sulfate Bound
5D27 1.92 Å, Crystal Structure of the P-Rex1 PH domain
4YON 1.95 Å, P-Rex1:Rac1 complex
5D3Y 1.95 Å, Crystal Structure of the P-Rex1 PH domain with Inositol-(1,3,4,5)-Tetrakisphosphate Bound
3QIK 2.29 Å, Crystal structure of the first PDZ domain of PREX1
6VSK 3.12 Å, Crystal structure of the P-Rex1 DEP1 domain
6PCV 3.2 Å, Single Particle Reconstruction of Phosphatidylinositol (3,4,5) trisphosphate-dependent…
5FI1 3.2 Å, Crystal Structure of the P-Rex1 DH/PH tandem in complex with Cdc42
7RX9 3.22 Å, Structure of autoinhibited P-Rex1
5FI0 3.28 Å, Crystal Structure of the P-Rex1 DH/PH tandem in complex with Rac1

Browse structure collections

About this viewer

MolViewer shows 8TUA directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.